(data stored in SCRATCH zone)

EMBL: CP002343.PE159

CP002343.PE159       Location/Qualifiers
FT   CDS_pept        complement(176995..177672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0160"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="InterPro IPR002941: IPR017985: IPR001091; KEGG:
FT                   cur:cur_0372 hypothetical protein; PFAM: DNA methylase
FT                   N-4/N-6 domain protein; SPTR: Putative uncharacterized
FT                   protein; PFAM: DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46721"
FT                   /db_xref="GOA:E6SFI3"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFI3"
FT                   /protein_id="ADU46721.1"
FT                   /translation="MPRPPLPPYLTATASELVAERAAGADGADEDVHFTEHLATEVIER
FT                   LSEPGDLVLDPFAGFGTTLLVADRLGRRGLGVELLPERVDVVRARVPAATIVEGDARGL
FT                   HRLLPDAGPVALCLTSPPYRTANDHPHDPLTAYTLVAGSYASYLADLASIAQALRRILR
FT                   PGGHLVLNVANIRHAGHTTALAWDVARAVGAVLPFQGETVVHWDTLPHDFTGDYLLTFR
FT                   RES"
     atgccgaggc ctcccctccc gccgtacctg acggcgaccg cgtccgagct cgtggccgag        60
     cgggccgccg gtgccgatgg cgccgacgag gacgtccact tcaccgagca cctcgccacc       120
     gaggtcatcg agcgcctgag cgagccgggg gacctcgtcc tcgacccgtt cgccgggttc       180
     ggcacgaccc tcctggtcgc ggaccggctc gggcggcgcg ggctcggcgt cgagctgctc       240
     cccgagcggg tcgacgtggt tcgcgcgcgc gttcccgcgg cgacgatcgt cgagggcgac       300
     gcccgcggcc tgcaccggct cctccctgac gcgggccccg tcgccctctg cctcacgtcg       360
     ccgccctacc gcaccgcgaa cgaccacccg cacgacccgc tcaccgccta cacgctcgtc       420
     gcgggcagct acgcgagcta cctcgcggac ctcgcgtcga tcgcgcaggc gctgcggcgc       480
     atcctccgcc ccggcggtca cctcgtgctc aacgtcgcca acatccgcca cgccggacac       540
     accaccgctc tcgcgtggga cgtcgcccgg gcggtcggcg ccgtgctccc gttccagggc       600
     gagaccgtcg tccactggga cacgctcccg cacgacttca ccggcgacta cctgctgacc       660
     ttccgacgcg agagctag                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page