(data stored in ACNUC7421 zone)

EMBL: CP002343.PE161

CP002343.PE161       Location/Qualifiers
FT   CDS_pept        178358..179032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0162"
FT                   /product="protein of unknown function SprT"
FT                   /note="InterPro IPR006640; KEGG: nca:Noca_3805 protein of
FT                   unknown function SprT; SMART: protein of unknown function
FT                   SprT; SPTR: Putative uncharacterized protein; PFAM:
FT                   SprT-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46723"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="UniProtKB/TrEMBL:E6S5Y3"
FT                   /protein_id="ADU46723.1"
FT                   /translation="MELSAALKLGRELMAVHGLSDWTLNLDRARTRAGVCRAGKREISL
FT                   SAHLTRLHPEAEVRDTILHEIAHALVGPGHGHDAVWRARARQIGCSGNRCSSVDAPGIA
FT                   GAWVGTCPAGHRTTRHRMPSRVVLCTRCRGTEAARVFDWTHQGRRVAMHPNYAAELDAL
FT                   LLGLPHLAPGRLGPGAVVRIAAPGQYDGAVGRIVTRGRTRYRVRVPDGLLSVPFAWVEQ
FT                   AG"
     atggagctga gtgctgcact gaaactgggc cgggagctga tggccgtcca cggcctgagc        60
     gactggacgc tgaacctcga ccgagcgagg acgcgggccg gggtctgccg ggcgggcaag       120
     cgggagatct cgctgagtgc ccatctgacg cggctccacc ccgaggccga ggtccgcgac       180
     acgatcctgc acgagatcgc ccatgcgctc gtcggtcccg ggcacggcca cgacgcggtg       240
     tggcgcgcca gggcccggca gatcggctgc tccggcaacc gctgctcctc cgtcgacgcc       300
     ccgggcatcg cgggggcgtg ggtggggacc tgccccgccg gccaccggac gacccggcac       360
     cggatgccgt cgcgagtcgt gctctgcacc cgctgccgcg gcacggaggc cgcccgcgtc       420
     ttcgactgga cccaccaggg acggcgggtg gcgatgcacc cgaactacgc ggccgagctc       480
     gacgccctgc tcctggggtt gccccacctc gcgccgggcc gcctcggacc cggtgcagtg       540
     gtccgcatcg cggctccggg tcagtacgac ggggcggtgg gtcggatcgt cacgcggggg       600
     cggacgcgct accgggtgcg ggtccccgac ggactgctct cggtgccctt cgcgtgggtg       660
     gagcaggccg gctga                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page