(data stored in ACNUC7421 zone)

EMBL: CP002343.PE169

CP002343.PE169       Location/Qualifiers
FT   CDS_pept        complement(185882..188074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0170"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tcu:Tcur_0118 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46731"
FT                   /db_xref="GOA:E6S5Z1"
FT                   /db_xref="UniProtKB/TrEMBL:E6S5Z1"
FT                   /protein_id="ADU46731.1"
FT                   /translation="MIRRHPVKALFAVLVLLVAALGWSYATRDSVPVPRTADPEPGESL
FT                   VVVGVGGISWDDVSPDRTPVLWGLLRDGAAASVSVKTLHLTTCPTDGWATLSAGEAAGP
FT                   RAEGDRPECTPLPEVVGDEQRGYSVAGFAQIAAASREAAFEARLGLLGDSFADHTSCVG
FT                   AIGPGAAIAAARSDGTVQRYTPFDEGTLVSELAQCPITLVDAGGILTTDPDPATHVEQT
FT                   TAIEQRIARVRDAMPTGADLIVAGLADRDQQERLRILTATGPHYAPGILASASTRMEGI
FT                   AQISDVTATILQRGGVRAVEPIGGRALSASPSPNNSESTAAKKLTRLTDIDTKADAMHR
FT                   IVVPFLVVWLASALLALLVLWILWQRARPWHTRLSRQRILRLTRLVGLVAAGMPAATFL
FT                   ANLVPWWRWSPPSSVLVALLSALVLLISGLIAVVCLNGPWGSSALGPLAVLSAVTASVI
FT                   GLDLMTGSRLQMSSIFGLQPLVGGRFYGMGNVAFALYGSAVILLCAAMAHALRRRNAPR
FT                   LAVVVVLVLGGAALAVDVLPAWGADFGGPIALVPALGLLLMRVAGIRVSVRSLALVGLA
FT                   AGLVVGLVCYLDWRRPEQYRSHPGRFFQTLLDGDAFTVVSRKLLANVELSTAHPALLAV
FT                   VLAVAAFVLVLVLQPGRFGTAPFARLVEEAPLLRDGLVAILVLSAIGFLTNDSGAAIPP
FT                   VAMVLTVPLVVAAVAAFMAIERANEPVRRRRDRHHR"
     gtgatccgca ggcatcccgt caaggcgctc ttcgccgtgc tggtcctgct ggtcgcagcc        60
     ctcgggtggt cctatgcgac gcgggactcg gttcccgtgc cccgcaccgc cgacccggag       120
     ccgggggagt cgctcgtcgt cgtcggtgtc ggcggtatct cctgggacga cgtctccccc       180
     gaccggacac cagtcctgtg gggtctcctg cgggacgggg cggccgcctc ggtgtcagtc       240
     aagaccttgc acctgacgac ctgccccacg gacggctggg cgaccctctc cgcaggtgag       300
     gccgccggtc cccgggcgga gggcgaccgc ccggagtgca cgcccctgcc cgaggtcgtc       360
     ggggacgagc agcgcggcta ctccgtcgcg ggtttcgcgc agatcgcggc cgcgtcccgg       420
     gaggcggcgt tcgaggcccg gctcggcctg ctcggcgaca gcttcgccga ccacacctcc       480
     tgcgtcggcg cgatcgggcc cggggcggcc atcgccgcgg cccgctccga cgggacggtg       540
     cagcggtaca cccccttcga cgagggaact ctggtgtcgg agctggcgca gtgcccgatc       600
     accctggtcg acgccggggg gatcctgacg acggaccccg acccggccac gcacgtcgag       660
     cagaccacgg cgatcgagca gcgcatcgcc cgggtgcggg acgccatgcc gaccggcgcg       720
     gacctcatcg tcgccgggct cgccgaccgc gaccagcagg agcggctgcg gatcctcacg       780
     gcaaccggcc cgcactacgc acccggcatc ctcgcgtccg cgtcgacccg gatggagggg       840
     atcgcgcaga tctccgacgt caccgcgacg atcctccagc gcggcggcgt ccgggccgtc       900
     gagccgatcg gcgggcgggc cctgtcggcc agcccgtcgc cgaacaacag cgagtcgacg       960
     gccgccaaga agctgacccg gctcaccgac atcgacacca aggccgacgc gatgcaccgc      1020
     atcgtcgtgc ccttcctcgt cgtgtggctg gccagcgccc tgctcgccct gctcgtgctg      1080
     tggatcctct ggcagcgcgc tcgtccctgg cacacgcgcc tgtcccgtca gcggatcctg      1140
     cgcctcaccc ggctcgtcgg gctcgtcgcg gccggaatgc ccgccgccac cttcctcgcc      1200
     aacctcgtgc cctggtggcg gtggtcgccg ccgtcctcgg tgctcgtcgc gctgctcagc      1260
     gccctcgtcc tgctcatcag cggactcatc gccgtggtct gcctcaacgg accctggggc      1320
     tcctcggccc tcggcccgct cgccgtcctg tcggccgtga ccgcgagcgt catcgggctc      1380
     gacctgatga ccggctcccg cctgcagatg tcctcgatct tcggactgca gcccctggtc      1440
     ggcggccgct tctacgggat gggcaacgtc gccttcgccc tctacggttc cgccgtgatc      1500
     ctcctctgcg cggcgatggc gcacgccctg aggcggcgca acgcccctcg gctcgccgtc      1560
     gtcgtcgtcc tcgtcctcgg aggtgccgcg ctggccgtcg acgtgttgcc ggcctggggt      1620
     gctgacttcg gcggcccgat cgccctggtg ccggcgctgg gtctgctcct gatgcgggtc      1680
     gcggggatcc gcgtctcggt gcggagcctg gcgctcgtcg gtctcgccgc agggctcgtc      1740
     gtcgggctcg tctgctacct cgactggcgc cgaccggagc agtaccgctc gcaccccggc      1800
     cgattcttcc agacgctgct cgacggggac gcgttcacgg tcgtgtcccg caagctgctg      1860
     gccaacgtcg agctgtccac cgcgcacccg gctctgctgg cggtggtcct cgccgtcgcc      1920
     gcgttcgtcc tcgtgctcgt gctccagccg ggccgcttcg gcacggcccc cttcgcgcgg      1980
     ctcgtcgagg aggccccgct gctgcgcgac gggctcgtcg ccatcctcgt cctgtcggcc      2040
     atcggcttcc tcaccaatga ctccggggcc gcgatccccc cggtggccat ggtcctcacc      2100
     gttccgctgg tcgtcgcggc cgtcgccgcg ttcatggcga tcgagcgcgc caacgagccg      2160
     gtccgacgcc ggcgtgaccg gcaccaccgc tga                                   2193
//

If you have problems or comments...

PBIL Back to PBIL home page