(data stored in ACNUC7421 zone)

EMBL: CP002343.PE17

CP002343.PE17        Location/Qualifiers
FT   CDS_pept        complement(20419..21846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0017"
FT                   /product="cell division protein FtsK/SpoIIIE"
FT                   /note="COGs: COG1674 DNA segregation ATPase FtsK/SpoIIIE
FT                   and related protein; InterPro IPR002543: IPR003593:
FT                   IPR000408; KEGG: fra:Francci3_4272 cell
FT                   divisionFtsK/SpoIIIE; PFAM: cell divisionFtsK/SpoIIIE;
FT                   SMART: AAA ATPase; SPTR: Cell divisionFtsK/SpoIIIE; PFAM:
FT                   FtsK/SpoIIIE family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46579"
FT                   /db_xref="GOA:E6SDX6"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDX6"
FT                   /protein_id="ADU46579.1"
FT                   /translation="MSTRGQARSALFDSDDLLAVALEAVVLGVLGVFRALWAALVMAVR
FT                   FPAAAVPLLLVVAAGVLLGSKGVALVLVMLAALLGAWRLKAPSSFSRHVSDRSAFMVRN
FT                   AIYRLRWTGVARRTDLVAHDGRLGRGRDPELVALLRVRPTTAGSDRLLLRLPTGLTPDD
FT                   VAGKADAIAHAFRSEAARIHPDRPGRVWLELRRADQLAAPILPLPQSDKLDLAALPVGH
FT                   AEDGSTWHLRLAGTHLLIAGATGAGKSSVLWSMLRALTRGIRQGLVEVWAVDPKGGMEL
FT                   RPGRALFARFEDSTPEDMCVVLEDLVVLKDSRAKQLAESGQRSHVAGAGSPHIIALLDE
FT                   LATLTAFADRAVTRRIDTALGLLLTQGRACGITVVAAVQDPGKDIVGWRDLFPTRVAMR
FT                   LDNPLQVAMVLGDGAREMGAKADEISELTPGVAFVRVEGTRQIKRVRAAYVNDNAIAEL
FT                   AAQISVSDEQNQREEVQ"
     atgagcaccc gaggccaagc ccgctcggcg ctcttcgaca gcgacgacct gctcgctgtg        60
     gctctcgagg ccgtggtgct cggagtgctt ggggtgttcc gcgccctctg ggcagccctc       120
     gtcatggcag tgcgcttccc ggctgccgca gtacctctgc tcctcgtggt cgcagccgga       180
     gtcctcctgg ggtcgaaggg agtcgcgctc gtcctcgtca tgcttgccgc tcttcttggt       240
     gcgtggaggt tgaaggcgcc gtcgagcttc agccggcacg tctccgaccg gtcggcgttc       300
     atggtgagga acgcgattta ccgactgcgc tggacaggcg tcgcccgccg aaccgatctg       360
     gtcgctcacg acggacgcct cggccggggc cgtgaccccg agctcgtggc cttgcttcgc       420
     gtgcgtccta cgaccgcagg atccgacagg ctcctgctcc ggctcccgac cggactcacc       480
     cccgacgacg ttgcaggcaa ggcagatgcc atcgcacacg ccttccgctc cgaggccgca       540
     cggatccacc ccgaccgccc aggcagggtc tggctcgagc tccgtagagc ggatcagctt       600
     gcggcaccca tcctgcccct gccccagtcc gacaaactcg acctggcagc actgcccgtg       660
     ggccatgcag aagacggctc tacctggcat ctgcggttgg cgggaaccca cctgctcatc       720
     gctggcgcca ccggtgcggg aaagagctcc gtgctctggt ccatgctccg agccctcact       780
     cgaggcatca gacagggcct cgtcgaagtc tgggcagtgg acccgaaggg aggcatggag       840
     ctaaggcccg gacgcgctct cttcgcgcgg ttcgaggact ccacccccga ggacatgtgc       900
     gtggtgcttg aggacctcgt cgtcctgaag gattcgcgcg ccaagcagct cgcggagtcc       960
     ggccagcgga gccatgtcgc cggtgccggc tccccacaca tcatcgcgct gctcgacgag      1020
     ctggccactc tcacagcttt cgccgaccgg gccgtgactc gacgcatcga caccgcgctc      1080
     gggctgctgc tcacgcaagg tcgagcgtgc ggcatcaccg tggtcgccgc tgtccaggac      1140
     ccgggaaagg acatcgtcgg ctggcgcgac ctcttcccga cccgcgtggc catgcgcctc      1200
     gacaaccccc tccaggtcgc catggtcctc ggcgacggag ccagggaaat gggagcaaag      1260
     gccgatgaga tcagcgaact gacccccggc gtcgcattcg tccgcgtcga ggggacccgt      1320
     cagatcaagc gcgtgcgtgc ggcatacgtc aacgacaacg ccatcgccga gctggcggct      1380
     cagatcagcg tcagcgacga gcagaaccag agggaggaag tgcaatga                   1428
//

If you have problems or comments...

PBIL Back to PBIL home page