(data stored in ACNUC7421 zone)

EMBL: CP002343.PE172

CP002343.PE172       Location/Qualifiers
FT   CDS_pept        189978..190367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0173"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_4153 outer membrane efflux protein;
FT                   SPTR: Outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46734"
FT                   /db_xref="UniProtKB/TrEMBL:E6S5Z4"
FT                   /protein_id="ADU46734.1"
FT                   /translation="MTDYVPGRLLVAGFPRTDDAPWLVELRLALAEVGLTFRLTAASRR
FT                   RTRRLRSTGGRALELLDAMWVSTVVLEPLVGPGVERPEIPQAWWVIERLRSRRPTLADR
FT                   LSLVETRRPATMGTEPLGLVIGVPA"
     atgacggact acgtgccggg gcggctgctc gtcgccggct tcccgcgcac cgatgacgcg        60
     ccgtggctcg tcgagctccg gctggcgctc gccgaggtgg gcctcacctt ccgcctcacg       120
     gcggcgagcc gacggcggac ccgccggctg cggtccacgg gcgggcgggc tctcgagctg       180
     ctcgacgcca tgtgggtctc cacggtggtg ctggagccgc tcgtcgggcc tggtgtcgag       240
     aggcccgaga tccctcaggc ctggtgggtg atcgagcgac tgcggagccg tcggccgacc       300
     ctggccgacc ggctgtcgct cgtcgagacc cgccgcccgg ccaccatggg gacggagccg       360
     ctcggcctcg tcatcggcgt gcccgcctag                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page