(data stored in SCRATCH zone)

EMBL: CP002343.PE173

CP002343.PE173       Location/Qualifiers
FT   CDS_pept        complement(190383..191543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0174"
FT                   /product="amidohydrolase"
FT                   /note="COGs: COG1228 Imidazolonepropionase and related
FT                   amidohydrolase; InterPro IPR006680; KEGG: mbt:JTY_0076
FT                   hypothetical protein; PFAM: amidohydrolase; SPTR: Putative
FT                   uncharacterized protein Mb0076; PFAM: Amidohydrolase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46735"
FT                   /db_xref="GOA:E6S5Z5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E6S5Z5"
FT                   /protein_id="ADU46735.1"
FT                   /translation="MHVIRADQVFDGDGFLGRTDVVLDGPNVVAVQEPTEYASEVVVED
FT                   LGAVTVLPGLVDAHQHLTWDAADPLAWHAEHDDSALLEQGRTNARRALSAGITTIRDLG
FT                   SRGRVALQLRDETARSPLAGPTLLVAGPALTTPGGHCWFLGGACTDADELVKAVARLDE
FT                   AGVDVIKVMATGGNITPGSAPHESQFRLPELKAVVDAAHAAGLPVAAHAHGTGGVSDAT
FT                   AAGVDTIEHCSFFTEDGIAEDPALIQRLAESGVAVSLTAGTPPGTTPLPAVAARMPALL
FT                   AHIRGLREAGVRCILGTDAGIGPGKPHDVLPLAVVQGVELVGIPVTEALAMCTSRAAEA
FT                   IGLGRRAGRLRAGGTADVLVVTGLVDEDPAALVRPARVLRGGVRVA"
     atgcacgtga tccgggccga ccaggtcttc gacggtgacg ggttcctggg ccggacggac        60
     gtcgtcctcg acggccccaa cgtcgtcgcg gtgcaggagc cgacggagta cgcgagcgag       120
     gtcgtggtcg aggacctcgg cgccgtcacc gtcctccccg gcctcgtcga cgcccaccag       180
     cacctgacgt gggacgccgc cgacccactc gcgtggcacg ccgagcacga cgactcggcg       240
     ctcctcgagc agggccgcac caacgcccgc cgggccctct ccgcggggat cacgacgatc       300
     cgcgacctgg gcagccgcgg tcgggtggct ctgcagctgc gcgacgagac cgcccgcagc       360
     cctctcgccg gcccgacgct gctggtcgcc ggccctgccc tgacgacccc cggcggtcac       420
     tgctggttcc tcggcggcgc ctgcaccgac gccgacgagc tcgtcaaggc ggtcgcccgc       480
     ctcgacgagg ccggtgtcga cgtcatcaag gtgatggcga ccggaggcaa catcacgccg       540
     ggctccgcgc cacacgagtc gcagttccgg ctgcccgagc tgaaggcggt cgtcgacgcg       600
     gcccacgccg ccgggctccc ggtcgccgcc catgcgcacg gcaccggcgg cgtctccgat       660
     gcgacggcgg ccggggtcga caccatcgag cactgcagct tcttcacgga ggacgggatc       720
     gccgaggacc ccgcgctgat ccaacgcctt gccgagtccg gcgtcgccgt gtccctgacc       780
     gcaggcaccc cccctggcac gacgcccctg ccagcggtcg ccgcccggat gccggccctc       840
     ctggcccaca tccgcggcct ccgtgaggcg ggagtgcgct gcatcctcgg gacggacgcc       900
     gggatcggcc cgggcaagcc gcacgacgtg ctgcccctcg ccgtcgtcca aggggtcgag       960
     ctggtcggga tcccggtcac cgaagcgctc gccatgtgca cctcgcgggc cgccgaggcc      1020
     atcgggctgg ggcgccgcgc cggccggctc cgcgccggcg gcaccgccga cgtcctcgtc      1080
     gtgaccggcc tcgtcgacga ggatcccgcg gccctcgttc ggcccgcccg ggtgctgaga      1140
     ggcggggtgc gggtcgcgtg a                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page