(data stored in SCRATCH zone)

EMBL: CP002343.PE174

CP002343.PE174       Location/Qualifiers
FT   CDS_pept        191685..192566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0175"
FT                   /product="iron permease FTR1"
FT                   /note="COGs: COG0672 High-affinity Fe2+/Pb2+ permease;
FT                   InterPro IPR004923; KEGG: amd:AMED_8204 high-affinity iron
FT                   transporter; PFAM: iron permease FTR1; SPTR: Putative
FT                   membrane protein; PFAM: Iron permease FTR1 family; TIGRFAM:
FT                   FTR1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46736"
FT                   /db_xref="GOA:E6S5Z6"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="UniProtKB/TrEMBL:E6S5Z6"
FT                   /protein_id="ADU46736.1"
FT                   /translation="MLVSNALIGLREGLEAALVVVILVAFLVKTGRHWALRWVWLGVGT
FT                   AVALSVVLGAVLTYGTSRLSFEQQELIGGFASIIAVVFVTGMVFWMRSAARTISGELRG
FT                   RLDRALDLGPLAVALVGFLGVGREGLETAIFFYATTQAAGAGNSQPLIGWVLGLTGAVA
FT                   LGGLIYRGAVRINLTAFFRWTGSLLVVVAAGILAYGLHDLQEAGLLPGLGAVAFDISSV
FT                   IAHDGWIGNLLRGIFNFTPQPTVVQAVAWSLYVAVILTLFLRPQRTSQPSEPAPSAPAD
FT                   LAARPSEPAPAN"
     atgcttgtga gcaatgccct catcggtctt cgcgaaggcc tcgaagccgc cctcgtcgtc        60
     gtcatcctcg tcgccttcct cgtcaagacc ggccgccact gggcgctgcg gtgggtgtgg       120
     ctcggagtcg ggaccgccgt cgcgctgtcc gtcgtcctcg gcgcggtcct cacctacggc       180
     acgagccggc tctccttcga gcagcaggag ctgatcggcg gcttcgcgtc catcatcgcc       240
     gtcgtcttcg tcacggggat ggtcttctgg atgcgctctg cggcgcgcac catctcgggc       300
     gagctgcggg gccgcctgga tcgggctctc gacctcggac cgctcgcggt ggccctcgtc       360
     ggcttcctcg gggtcggccg cgaggggctc gagacggcga tcttcttcta cgcgacgacg       420
     caggcggccg gcgcaggcaa ctcgcagccg ctcatcggct gggtcctcgg cctcacggga       480
     gcggtcgccc tcgggggtct gatctaccgt ggcgccgtcc ggatcaacct caccgccttc       540
     ttccgctgga cggggagcct gctcgtcgtc gtcgcggccg gcatcctcgc ctacgggctg       600
     cacgacctcc aggaagccgg tctcctcccg ggcctgggcg ccgtcgcgtt cgacatcagc       660
     tccgtcatcg cccacgacgg ctggatcggc aacctgctcc gcggcatctt caacttcacg       720
     ccgcagccga ccgtggtcca ggcggtggcc tggtcgctct acgtcgcggt catcctcacc       780
     ctcttcctcc gtccccagcg cacctctcag ccgagcgagc ctgcgccgag tgctcctgcc       840
     gacctggccg cgcgccccag cgagccggcc ccggcgaact ga                          882
//

If you have problems or comments...

PBIL Back to PBIL home page