(data stored in ACNUC7421 zone)

EMBL: CP002343.PE175

CP002343.PE175       Location/Qualifiers
FT   CDS_pept        complement(193726..194838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0178"
FT                   /product="diacylglycerol kinase catalytic region"
FT                   /note="COGs: COG1597 Sphingosine kinase; InterPro
FT                   IPR001206; KEGG: xce:Xcel_3229 diacylglycerol kinase
FT                   catalytic region; PFAM: diacylglycerol kinase catalytic
FT                   region; SMART: diacylglycerol kinase catalytic region;
FT                   SPTR: Putative uncharacterized protein; PFAM:
FT                   Diacylglycerol kinase catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46737"
FT                   /db_xref="GOA:E6S5Z7"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:E6S5Z7"
FT                   /protein_id="ADU46737.1"
FT                   /translation="MPNDYLPWIIAGIVALALGVGVVLGTRTAARSTTALRRRRGRGRP
FT                   SRDQFRSGQRSTALKRAAVVVNPTKFADLPMIHERITSTSHACGWGDPLFYETTVADPG
FT                   TGQAERAVAEGASVVCSLGGDGTVRAVASGLIGTETPLGILPAGTGNLLARNLDLPVLA
FT                   LDEAVRVALTGRNRRIDVGEVVIGEMDAHGQPVGGGELVTQQFLVMAGMGLDALIMGGT
FT                   NEALKQRVGWAAYLLTGFKHLVSPEFRTQVRLDAEPEFKRRARAVVIGNCGRLLGGLVL
FT                   MPDARVDDQQLDVVIASPRGFVGWAPVIARVLTRQRKGHSTLDHKVCREIRVRVDHPLP
FT                   VQVDGDVVGEATEINATVRPAALTVRVPIT"
     gtgcccaacg actacctgcc gtggatcatc gccggcatcg tggcgctggc actcggggtc        60
     ggggtcgtcc tgggcacgcg gaccgctgct cgctcgacga ccgccctgcg gcgccggcgc       120
     gggcggggtc gtcccagtcg cgaccagttc cgctcgggcc agcgcagcac cgccctcaag       180
     cgggcggccg tcgtcgtcaa cccgacgaag ttcgccgacc tgccgatgat ccacgagcgg       240
     atcacctcga cctcgcacgc ctgcggctgg ggtgaccccc tcttctacga gacgaccgtg       300
     gccgaccctg gcaccggcca ggccgagcgg gccgtggccg agggggcgag cgtcgtctgc       360
     agcctcggcg gcgacggcac ggtgcgcgcc gtcgcgagcg gcctcatcgg cacggagacg       420
     cccctcggca tcctcccggc ggggaccggc aacctgctcg cgcgcaatct cgacctgccg       480
     gtgctcgctc tcgacgaggc cgtccgggtc gcactcacgg ggcggaaccg ccgcatcgac       540
     gtcggcgagg tcgtcatcgg agagatggac gcgcacgggc agccggtcgg cggtggcgag       600
     ctggtcaccc aacagttcct cgtcatggcc ggcatgggtc tcgacgccct catcatgggc       660
     ggcaccaacg aggccctcaa gcagcgcgtc ggctgggcgg cctacctgct gaccggcttc       720
     aagcacctcg tgtccccgga gttccgcacc caggtccggc tcgacgcgga gccggagttc       780
     aagcgtcggg cccgcgccgt cgtcatcggc aactgtggtc ggctgctcgg cggcctggtc       840
     ctcatgcccg acgcccgcgt cgacgaccag cagctcgacg tcgtcatcgc ctcgccccgc       900
     ggcttcgtcg ggtgggcccc ggtcatcgct cgtgtcctca cccgacagcg caagggtcac       960
     tccacgctcg accacaaggt ctgtcgcgag atcagggtgc gcgtcgacca tcccctgccc      1020
     gtgcaggtcg acggcgacgt cgtcggcgag gccaccgaga tcaacgcgac cgtccgcccc      1080
     gcggccctga ccgtccgcgt ccccatcacc tga                                   1113
//

If you have problems or comments...

PBIL Back to PBIL home page