(data stored in ACNUC7421 zone)

EMBL: CP002343.PE177

CP002343.PE177       Location/Qualifiers
FT   CDS_pept        195448..196506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0180"
FT                   /product="oxidoreductase domain protein"
FT                   /note="COGs: COG0673 dehydrogenase and related protein;
FT                   InterPro IPR000683: IPR004104; KEGG: cfl:Cfla_0574
FT                   oxidoreductase domain protein; PFAM: oxidoreductase domain
FT                   protein; Oxidoreductase domain; SPTR: Oxidoreductase domain
FT                   protein; PFAM: Oxidoreductase family, NAD-binding Rossmann
FT                   fold"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46739"
FT                   /db_xref="GOA:E6S5Z9"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6S5Z9"
FT                   /protein_id="ADU46739.1"
FT                   /translation="MSPVAVGGNAHALPEARVPDPREAPPIRWGILAPGGIANEFAAAV
FT                   TAGTASTVVAVGSRSEQRARDFADRHHIPRAFGSYEALVADEAVDAVYVASPHSEHHDH
FT                   ALLALEAGKPVLVEKAFTRNVTEARAVIRAGADRGLLVAEAMWARYLPHYDVVRQVLDG
FT                   GVLGDLVLLRADHSQLLHPNGPERLARPELAGGALLDLGVYPVSFADHLLGPPASVAAR
FT                   GSLTECGVDATVGIVLAYVSGAVAVLTCSMLARTPCAAEIIGTEARLELDGPFYAPTAV
FT                   RLLSPAGEVLAERPGTLPGPLRGFSYQAAEFARCLSAGSRECPAMPHAATLRVMSTMDE
FT                   IRAQVGVRYPGE"
     atgagccccg tcgcagtcgg cgggaacgcc cacgctcttc ccgaggcccg cgtcccggac        60
     ccgcgtgagg cgccgccgat ccgctggggg atcctcgccc ccggaggcat cgccaacgag       120
     ttcgccgccg ccgtcacggc cggcaccgcg tccaccgtcg tcgcggtggg gtcgcggagc       180
     gagcagcgag cccgcgactt cgcggaccgg caccacatcc cccgggcctt cggctcctat       240
     gaggcactcg tcgccgacga agcggtcgac gccgtctatg tcgcctcgcc ccactccgag       300
     caccacgacc acgcgctgct cgcgctcgaa gccggcaagc cggtcctcgt cgagaaggcc       360
     ttcacccgca acgtcaccga ggctcgcgcc gtgatccgcg ccggcgcgga ccgcgggctg       420
     ctcgtggcgg aggcgatgtg ggcgcgctac ctgccgcact acgacgtggt ccgacaggtc       480
     ctcgacggag gcgtcctcgg ggacctcgtc ctcctccgcg ccgaccactc acagctgctc       540
     cacccgaacg ggccggaacg gctggcccgc cccgagctgg cgggtggggc gctcctcgac       600
     ctcggggtct acccggtgtc cttcgccgac cacctgctcg gcccgccggc ctccgtggcg       660
     gcccgcggct ccctcacgga gtgcggcgtc gacgcgacgg tcggcatcgt cctcgcctac       720
     gtctcaggag cggtcgccgt actgacctgc tcgatgctgg cgcggacgcc gtgcgcagcg       780
     gagatcatcg gcaccgaggc ccggctcgag ctcgacggcc cgttctacgc gcccaccgcg       840
     gttcggctgc tcagcccggc cggggaggtc ctcgccgaac gccccggcac cctgcccggc       900
     ccgctccgtg ggttcagcta ccaggcagcc gagttcgcgc gctgcctgtc cgccggctcc       960
     cgcgagtgtc ccgccatgcc gcacgcggcg acgctccggg tcatgtcgac gatggacgag      1020
     atccgcgcac aggtcggggt gcgctacccg ggggagtga                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page