(data stored in ACNUC7421 zone)

EMBL: CP002343.PE178

CP002343.PE178       Location/Qualifiers
FT   CDS_pept        complement(196555..197370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0181"
FT                   /product="pentapeptide repeat protein"
FT                   /note="COGs: COG1357 Uncharacterized low-complexity
FT                   protein; InterPro IPR001646; KEGG: kfl:Kfla_5660
FT                   pentapeptide repeat protein; PFAM: pentapeptide repeat
FT                   protein; SPTR: Pentapeptide repeat protein; PFAM: Protein
FT                   of unknown function (DUF664); Pentapeptide repeats (8
FT                   copies)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46740"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:E6S600"
FT                   /protein_id="ADU46740.1"
FT                   /translation="MERFHDADLSGSEFEHVRLVGAQLRRVDLTGARFQTVDLTGAAFR
FT                   DVDFSGAQLRGVLVREADVSGEILSLTVNGVDVVPLVEAELDRRDPERPTLLRPTDPAG
FT                   FREAWAINERRWAGTVERARLLPAEALYQSVDGEWSFIETLRHLAFATDSWVSRAIQGD
FT                   PSPWHPLELPWDEMPDTPGVPRDRAARPSLDEALALRHDGMARVGRLLEGLTDESLAAQ
FT                   TTPVDGPGWPEPRSYPVRECLLTVLNEEYHHRLFAERDLSVLEAGDSGT"
     atggagcggt tccacgatgc tgacctgtcc ggttcggagt tcgagcacgt gcggttggtc        60
     ggggcccagc tgcgccgtgt cgacctgacc ggagcccggt tccagaccgt cgacctgacc       120
     ggcgcggcct tccgggacgt cgacttctcc ggcgcgcagc tgcggggtgt gctcgtccgg       180
     gaggccgacg tctcgggtga gatcctcagc ctgacggtga acggcgtcga cgtcgtcccc       240
     ctcgtcgagg ccgagctaga ccgccgggac cccgagcggc cgacgctgct gcgcccgacc       300
     gaccccgcgg ggttccggga ggcgtgggcg atcaacgaac ggcgctgggc cgggacggtg       360
     gagcgggctc gcctgctgcc ggccgaggcg ctctaccagt cggtcgacgg cgagtggtcc       420
     ttcatcgaga cgctccgcca cctggcgttc gccacggact cgtgggtcag ccgcgccatc       480
     cagggcgacc cgtcaccctg gcacccgctc gagctgccgt gggacgagat gccggacacc       540
     ccgggcgtgc cccgggaccg tgcggcccgg ccgtcgctcg acgaggcgct cgcgctgcga       600
     cacgacggga tggcccgggt gggtcgcctc ctcgaggggc tcaccgacga gtcgttggcg       660
     gcgcagacga caccggtcga cggccctggc tggccggagc cgcgcagcta cccggtgcgg       720
     gagtgcctgc tcaccgtcct caacgaggag taccaccacc ggctcttcgc cgagcgggac       780
     ctctccgtcc tggaggccgg tgacagtggc acgtag                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page