(data stored in ACNUC7421 zone)

EMBL: CP002343.PE179

CP002343.PE179       Location/Qualifiers
FT   CDS_pept        complement(197444..198877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0182"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /note="COGs: COG0364 Glucose-6-phosphate 1-dehydrogenase;
FT                   InterPro IPR001282: IPR019796; KEGG: mjl:Mjls_5357
FT                   glucose-6-phosphate 1-dehydrogenase; PFAM:
FT                   glucose-6-phosphate dehydrogenase; PRIAM:
FT                   Glucose-6-phosphate dehydrogenase; SPTR:
FT                   Glucose-6-phosphate 1-dehydrogenase; TIGRFAM:
FT                   glucose-6-phosphate 1-dehydrogenase; PFAM:
FT                   Glucose-6-phosphate dehydrogenase, C-terminal domain;
FT                   Glucose-6-phosphate dehydrogenase, NAD binding domain;
FT                   TIGRFAM: glucose-6-phosphate 1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46741"
FT                   /db_xref="GOA:E6S601"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6S601"
FT                   /protein_id="ADU46741.1"
FT                   /translation="MPATTVVLFGATGDLAKRKLLPGMLHLHESQLLEGLRIVATSLED
FT                   LTRDEFLDLVVDSVRTHSSRDVTDEDLREFADRIHWVPGSGGPAALRQAVLDSEEILGS
FT                   GARRLHYLSVPPAAALAVVRQIAAAGLVERSRIIMEKPFGTDLASARKLNAELHEVFAE
FT                   EQIFRIDHFLGKEPAQNILAFRFANGLFEPIWHRNHIDHIQIDVPETLGLEQRADFYEA
FT                   TGAYRDMVVTHLFQVLAFTAMEPPTSLEPSAITEEKSKVFRSMLTIDPHDVVRGQYVGY
FT                   RDEEGVAPDSETETFVALKCFVDNWRWAGVPFFLRTGKRMSEGARIISIAFKEPPRTMF
FT                   PPSSGVGDDGPDHLTFDLADRARMSLSFYGKRPGPGMALDKLSMQFSMQDTDWAGAALE
FT                   AYERLIYDAARGDATLFTRAEGIERLWEISQPLLDNPPPVRPYQQGTWGPNQIHQLVAP
FT                   FAWRLPFERPWRDPNLMGA"
     atgcccgcga ccaccgttgt cctgttcggc gccaccggag acctggccaa gcgcaagctc        60
     ctgcccggga tgctgcacct gcacgagtcg cagctgctcg agggcctgcg catcgtggcg       120
     accagtctcg aggacctgac ccgcgacgag ttcctcgacc tcgtcgtcga ctcggtgcgc       180
     acgcactcga gtcgggacgt gacggacgag gacctgcgcg agttcgccga ccggatccac       240
     tgggtccccg gctccggggg tccggccgcg ctccggcagg ccgtcctcga ctcggaggag       300
     atcctcgggt cgggcgcgcg acgcctccac tacctgtccg tgccaccggc cgcagccttg       360
     gccgtggtgc gccagatcgc ggcggccggg ctcgtggagc gcagccggat catcatggag       420
     aagccgttcg gcaccgacct cgcgagcgcc aggaagctca acgccgagct ccacgaggtg       480
     ttcgccgagg agcagatctt ccggatcgac cacttcctcg gcaaggagcc ggcgcagaac       540
     atcctcgcgt tccggttcgc gaacgggctg ttcgagccga tctggcaccg caaccacatc       600
     gaccacatcc agatcgacgt gccggagacc ctcgggctgg agcagcgcgc ggacttctac       660
     gaggcgaccg gcgcctaccg cgacatggtc gtcacgcacc tgttccaggt gctcgccttc       720
     accgcgatgg agccgccgac ctcgctcgag ccctcggcga tcaccgagga gaagagcaag       780
     gtcttccggt cgatgctcac gatcgacccg cacgacgtcg tgcgggggca gtacgtcggc       840
     taccgcgacg aggagggcgt cgccccggac tccgagacgg agacgttcgt cgcgctgaag       900
     tgctttgtgg acaactggcg ctgggcgggg gtcccgttct tcctccgcac gggcaagcgg       960
     atgtccgagg gcgcccggat catctcgatc gccttcaagg agccaccgcg gacgatgttc      1020
     ccgccgagct cgggcgtcgg cgacgacggg cccgaccacc tgaccttcga cctcgcggac      1080
     cgcgcgcgca tgtcgttgtc gttctacggc aagcggcccg gccccgggat ggcgctcgac      1140
     aagctgtcga tgcagttctc gatgcaggac accgactggg cgggtgcggc gctcgaggcg      1200
     tacgagcggc tcatctacga cgcggcccgt ggggacgcga cgctcttcac gcgggccgag      1260
     gggatcgagc ggctgtggga gatcagccag ccgctcctcg acaacccgcc tccggtgcgc      1320
     ccctaccaac aggggacgtg ggggccgaac cagatccacc agctggtcgc cccgttcgcg      1380
     tggcggctgc ccttcgagcg gccctggcgc gacccgaacc tcatgggcgc ctga            1434
//

If you have problems or comments...

PBIL Back to PBIL home page