(data stored in ACNUC7421 zone)

EMBL: CP002343.PE181

CP002343.PE181       Location/Qualifiers
FT   CDS_pept        200356..201291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0184"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1131 ABC-type multidrug transport system
FT                   ATPase component; InterPro IPR003439: IPR003593: IPR017871;
FT                   KEGG: nca:Noca_4497 ABC transporter related; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase; SPTR: ABC
FT                   transporter related; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46743"
FT                   /db_xref="GOA:E6S603"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6S603"
FT                   /protein_id="ADU46743.1"
FT                   /translation="MCRAVADRHRGPMIHVDRLTKRYGPFTAVDDISFEVRPGQVTGFL
FT                   GPNGAGKSTAMRIMAGLTPATSGTATVLGRAYGHLPNPGRHVGVLLDASAQHAGRTGRE
FT                   ILSLSAIMMGVDRRRVDEMLDLVGLTDKEAARRVRNYSLGMRQRLGIANALLGDPEVLI
FT                   LDEPANGLDPAGIRWMRDLLRGYANQGGTVLLSSHLLNEIERVADEIIVIGHGRIVAQG
FT                   TKDALLSGAGTYVRSTDDAGLAAALALEDISVSPAATGGLHVDAEPMTVGQVAAASGVV
FT                   LVELRSGDSRGLEEMFLELTAATAREEVAA"
     atgtgccggg cggtggccga ccggcaccgt ggtcccatga tccacgtaga ccgactgacc        60
     aagcgatacg gccccttcac ggcggtcgac gacatctcgt tcgaggtgag gcccgggcag       120
     gtgaccggct tcctcggccc gaacggcgcg ggcaagtcca ccgccatgcg catcatggcc       180
     ggcctcaccc cggccacgtc cggcaccgcg acggtgctgg gccgcgccta cgggcacctg       240
     cccaacccgg gtcgccacgt cggcgtcctt ctcgacgcct cagcccagca cgcggggcgc       300
     accggtcgag agatcctcag cctgagcgcc atcatgatgg gcgtcgaccg ccggcgggtc       360
     gacgagatgc tcgacctcgt cgggctcacc gacaaggagg ctgcccgccg ggtccggaac       420
     tactccctcg gcatgcgcca gcggctgggc atcgccaacg ccctcctcgg cgacccggag       480
     gtcctcatcc tcgacgagcc tgccaacggg ctcgacccgg ccgggatccg gtggatgcgg       540
     gacctgctcc gcggctacgc caaccagggc ggcacggtgc tgctcagctc gcacctgctc       600
     aacgagatcg agcgcgtcgc cgacgagatc atcgtcatcg ggcacggtcg gatcgtcgcc       660
     cagggcacga aggacgcgct gctgtccggc gccggcacct acgtccggtc caccgacgac       720
     gccggccttg cggcggccct cgctctcgag gacatctcgg tctcacccgc cgccacgggc       780
     gggctgcacg tcgacgccga gcccatgacg gtcggccagg tcgccgccgc atccggagtc       840
     gtcctcgtcg agctccggtc cggcgacagc cgcggcctcg aggagatgtt cctcgagctc       900
     acggcggcga cggcccgcga ggaggtggcg gcatga                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page