(data stored in ACNUC7421 zone)

EMBL: CP002343.PE183

CP002343.PE183       Location/Qualifiers
FT   CDS_pept        complement(202245..202988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0186"
FT                   /product="cobalt ABC transporter, ATPase subunit"
FT                   /note="COGs: COG1122 ABC-type cobalt transport system
FT                   ATPase component; InterPro IPR003439: IPR005876: IPR003593:
FT                   IPR017871; KEGG: sro:Sros_0995 cobalt ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase; SPTR: Cobalt ABC transporter, ATPase subunit;
FT                   TIGRFAM: cobalt ABC transporter, ATPase subunit; PFAM: ABC
FT                   transporter; TIGRFAM: cobalt transport protein ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46745"
FT                   /db_xref="GOA:E6S605"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005876"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6S605"
FT                   /protein_id="ADU46745.1"
FT                   /translation="MSGAPVLDVRGLAYAYPDGHQALFGVDLQVGRGERVSLLGPNGAG
FT                   KTTLVLHLNGILTAGAGAVTVSGLPVTKANLREIRRRVGIVFQDPDDQLFMPTVRDDVA
FT                   FGPANLGLRGDELDSRVHRALDQVGMVEFVDRPPHHLSFGQRRRVAVATVLAMEPEILV
FT                   LDEPSSNLDPASRRELAEILRSLDVTVLMVTHDLPYALELCERAVVLSGGVIAADGPTR
FT                   DLLADADLMARHRLELPYGFTVPTP"
     atgagcggcg cccccgtcct cgacgttcgc gggctcgcct acgcctaccc cgacgggcac        60
     caggctctct tcggcgtcga cctccaggtg ggcaggggcg agcgagtgtc gctcctcggg       120
     cccaacggtg ccgggaagac cactctggtg ctgcacctca acggcattct caccgccggt       180
     gctggtgccg tcacggtctc gggcctcccg gtgacgaagg ccaatctccg ggagatccgc       240
     cgccgtgtgg gcatcgtctt ccaggatccg gacgaccagc tcttcatgcc gacggtccgc       300
     gacgacgtgg cgttcgggcc ggccaacctc ggactgcgtg gggacgagct cgacagccgc       360
     gtccaccggg ccctcgacca ggtgggcatg gtcgagttcg tcgaccgccc gccgcaccac       420
     ctgtccttcg gccagcggcg ccgggtggcc gtcgccaccg tgctcgcgat ggagccggag       480
     atcctcgtcc tcgacgagcc gtcctcgaac ctcgacccgg cgtcacgccg cgagctggcc       540
     gagatcctcc ggtccctcga cgtcaccgtt ctcatggtga cgcacgacct gccctacgcc       600
     ctcgagctgt gcgagcgcgc cgtggtcctg tccggcgggg tcatcgccgc ggacgggccc       660
     acccgggatc tgctcgcaga cgcggatctc atggccaggc accggctcga gctgccctac       720
     ggcttcaccg tcccgactcc gtga                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page