(data stored in SCRATCH zone)

EMBL: CP002343.PE184

CP002343.PE184       Location/Qualifiers
FT   CDS_pept        complement(202985..203749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0187"
FT                   /product="cobalt ABC transporter, inner membrane subunit
FT                   CbiQ"
FT                   /note="COGs: COG0619 ABC-type cobalt transport system
FT                   permease component CbiQ and related transporter; InterPro
FT                   IPR003339: IPR012809; KEGG: nca:Noca_1329 cobalt ABC
FT                   transporter, inner membrane subunit CbiQ; PFAM: cobalt
FT                   transport protein; SPTR: Cobalt ABC transporter, inner
FT                   membrane subunit CbiQ; TIGRFAM: cobalt ABC transporter,
FT                   inner membrane subunit CbiQ; PFAM: Cobalt transport
FT                   protein; TIGRFAM: cobalt ABC transporter, permease protein
FT                   CbiQ"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46746"
FT                   /db_xref="GOA:E6S606"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR012809"
FT                   /db_xref="UniProtKB/TrEMBL:E6S606"
FT                   /protein_id="ADU46746.1"
FT                   /translation="MGAPHGHALHFHGHSPVHRLPAHVKIVVLVGYVLAVVATPRGVFW
FT                   PYAAHLLALAGAVAVSRVPLAHLAKRLVIEVPFVVFALVLPFVATGPRTAVGPVEISQP
FT                   GLEAAAALLAKGTLGVLASLLLAATTEPRDIVAGFEKLRLPQSLVQIMSFMLRYTEVVA
FT                   ADLGRMRVARESRGFRARSVRQWPALGATLGALFIRSYERGERVHLAMLSRGYTGRLPT
FT                   LRPLTATGSQWAASGLLPIACGLVSAAAVLAG"
     atgggagcac cccacgggca cgccctccac ttccacggcc actcgccggt gcatcggctc        60
     ccggcccacg tgaagatcgt cgtcctcgtc ggctacgtcc tcgctgtcgt ggccactccc       120
     cgaggcgtct tctggccgta tgccgctcac ctcctcgcgc tcgccggtgc cgtcgccgtg       180
     tcgcgagtcc cgttggcgca cctggccaag cggctcgtca tcgaggtgcc cttcgtggtc       240
     ttcgccctcg tcctgccctt cgtcgccact gggccgcgga ccgcagtcgg gccggtcgag       300
     atctcacagc cgggcctcga ggcggctgct gccctcttgg cgaagggaac cctcggcgtc       360
     ctcgcctcgc tgctcctggc ggcgaccacg gagccccggg acatcgtcgc cggcttcgag       420
     aagctgcgcc tgccgcagtc cctcgtccag atcatgagct tcatgctccg ctacaccgag       480
     gtcgtcgccg cagacctcgg gcggatgcgg gtcgcacggg agtcgagggg cttccgcgcc       540
     cggtcggtcc gccagtggcc cgcgctcggg gccaccctgg gcgccctctt catccggtcc       600
     tatgagcggg gggaacgcgt gcacctggcg atgctgtcgc gcggctacac cgggcgactg       660
     ccgacgctcc ggccgctcac ggccaccggc tcgcagtggg cggccagcgg cctgctgccc       720
     atcgcgtgcg gcctcgtcag cgcggcggcg gtgctggccg gatga                       765
//

If you have problems or comments...

PBIL Back to PBIL home page