(data stored in ACNUC7421 zone)

EMBL: CP002343.PE187

CP002343.PE187       Location/Qualifiers
FT   CDS_pept        206637..208019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0191"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase
FT                   dimerization region"
FT                   /note="COGs: COG1249 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex dihydrolipoamide dehydrogenase (E3); InterPro
FT                   IPR001327: IPR004099: IPR013027: IPR000815; KEGG:
FT                   sco:SCO3443 pyridine nucleotide-disulphide oxidoreductase;
FT                   PFAM: pyridine nucleotide-disulphide oxidoreductase
FT                   dimerisation region; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; SPTR: Putative
FT                   pyridine nucleotide-disulphide oxidoreductase; PFAM:
FT                   Pyridine nucleotide-disulphide oxidoreductase; Pyridine
FT                   nucleotide-disulphide oxidoreductase, dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46749"
FT                   /db_xref="GOA:E6S609"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6S609"
FT                   /protein_id="ADU46749.1"
FT                   /translation="MESFDIIVVGMGPGGEHVANTLAERGLRVLGVDHGLVGGECPYWG
FT                   CIPTKMMVRAADALAEARRVDGLAGSVADVTPDWSLVARRIRDEATDGWDDQVAVERFT
FT                   QKGGTFLRGTGRVVGPGRVDVDGKPYAAGRGIVVNVGSRAATPPIEGLEGVPFWTNREF
FT                   AEATALPGSLVVLGGGAIGCELAQVAARFGTTVTVVESAPRLLSPEEPEASERIATVFE
FT                   REGITVHVGSAAATVAASPTPGEADQVEVTLEDGTVLRAERLLVATGRRTDPGAVGLGS
FT                   VGVAADARVAPTDEWCRVAPGVWAVGDITGKGAFTHVSMYQAAIVVRDVLGEAGPPADY
FT                   RAVPRVTFTDPEVATVGLTEAQARDQGVEVRTGFTALGSTTRGWIHGVGGDGFIKLVAD
FT                   PGRGLLVGATVMGPAAGEVMGALAVAVHAEVPLDRLRSMIHAYPTFHRGIEDALADLDQ
FT                   RS"
     atggagagct tcgacatcat cgtcgtcggg atgggtccgg gcggcgagca cgtggcgaac        60
     accctggctg agcggggcct gcgcgtcctc ggcgtcgacc atggactggt ggggggcgag       120
     tgtccctact ggggctgcat cccgacgaag atgatggtcc gcgccgcaga tgccctggcc       180
     gaggcgcgac gggtggacgg gctggccggg tcggtcgcgg acgtgacgcc ggactggtcg       240
     ctggtggcgc gtcgcatccg tgacgaggcc acggacggct gggacgacca ggtcgccgtc       300
     gaacggttca cccagaaggg tgggacgttc ctgcgcggca ccggccgggt cgtcgggccc       360
     ggccgcgtcg acgtcgacgg caagccgtat gccgctgggc gcgggatcgt ggtcaacgtc       420
     ggctcccgcg cggcgacgcc tcccatcgag ggactcgagg gggtgccctt ctggaccaat       480
     cgcgagttcg ccgaggcgac ggctctcccc gggtcactcg tcgtcctcgg gggtggtgcg       540
     atcgggtgcg agctggcgca ggtcgctgcc cggttcggga ccacggtcac cgtggtggag       600
     tcggcgcctc gcctcctgtc acccgaggag ccggaggcgt ccgagcggat cgcgacggtc       660
     ttcgagcggg aggggatcac cgtgcacgtc ggctccgccg cagcgaccgt cgccgcgtcc       720
     ccgacgcccg gggaggccga ccaggtcgag gtgaccctcg aggacgggac ggtcctgcga       780
     gccgagcgac tcctcgtggc gaccggacgt cgaaccgacc cgggtgcggt gggcctcggc       840
     tccgtcgggg tggccgccga cgccagggtg gccccgaccg acgagtggtg ccgagtcgcc       900
     ccaggagtgt gggcggtcgg cgacatcacc ggtaagggtg ccttcaccca cgtctcgatg       960
     taccaggccg caatcgtcgt ccgggacgtc ctcggtgagg cggggccacc ggccgactac      1020
     cgggccgttc cgcgggtcac cttcacggac ccggaggtgg cgaccgtggg gctgaccgag      1080
     gcgcaggcgc gggaccaggg ggtcgaggtc aggacgggct tcaccgcact cggctcgacg      1140
     acacgcgggt ggatccacgg cgtcggcggc gacggtttca tcaagctcgt cgccgacccg      1200
     gggcgggggc tcctcgtcgg ggcgaccgtc atggggccgg cggcgggcga ggtgatgggc      1260
     gcgctcgccg tggccgtgca cgccgaggtg ccgctcgacc ggctccggtc gatgatccat      1320
     gcctacccga ccttccaccg gggcatcgag gacgccctgg ccgatctgga ccagaggtcc      1380
     tga                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page