(data stored in ACNUC7421 zone)

EMBL: CP002343.PE193

CP002343.PE193       Location/Qualifiers
FT   CDS_pept        212281..212721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0197"
FT                   /product="YCII-related protein"
FT                   /note="COGs: COG3795 conserved hypothetical protein;
FT                   InterPro IPR005545; KEGG: pfo:Pfl01_2519 DGPFAETKE; PFAM:
FT                   YCII-related; SPTR: Conserved DGPFAETKE domain protein;
FT                   PFAM: YCII-related domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46755"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:E6S615"
FT                   /protein_id="ADU46755.1"
FT                   /translation="MRYLIIVPGGPETESDTIGTEQQLADMQSYQEEMLRAGVYVDGQG
FT                   LHPTAKGALVSFEDDEWVVTDGPFAEAKEIIAGFSVIDVSSREEALEWVKRWPRSCAPG
FT                   PGQALELRQMYAPEDFDEQLSPELRERERALREAAARQAAQG"
     atgcggtacc tcatcatcgt cccgggaggc ccggagacgg agagcgacac catcggcacg        60
     gagcagcagc tggcggacat gcagtcgtac caggaggaga tgctccgcgc cggcgtctac       120
     gtcgacggcc agggcctcca ccccacggcc aagggtgcgc tcgtctcatt cgaggacgac       180
     gagtgggtcg tcaccgacgg cccgttcgcc gaggcgaagg agatcatcgc cggcttctcc       240
     gtcatcgacg tgtcgtcgcg ggaggaggcc ctcgaatggg tcaagcggtg gccgcggtcc       300
     tgcgcgcccg gtcccggcca ggcgctcgag ctgcggcaga tgtacgcgcc ggaggacttc       360
     gacgagcagc tgagcccgga gctgcgcgag cgtgagcggg ccctgcgcga agccgctgcc       420
     cggcaggccg cccagggctg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page