(data stored in SCRATCH zone)

EMBL: CP002343.PE195

CP002343.PE195       Location/Qualifiers
FT   CDS_pept        214168..215091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0199"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:blr0248 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Uracil DNA
FT                   glycosylase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46757"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:E6S617"
FT                   /protein_id="ADU46757.1"
FT                   /translation="MVTHRSCPGYVDEPFASLVADYPGAEAYPPGDFRVEWGPVFHRGR
FT                   LDGSARVLVIGQDPATHEAISRRVLVGEAGQRVQGLLARLGITHSYVMLNVYLYSVFGQ
FT                   AAGYRHVKDPDIVDYRHRWLDAVLLDSASPSVTPSVTPSVTPSVTPSVTPSVASSGVTA
FT                   VIALGTLAKRAFGLWEDSSPEREARSRRLHLAAVRHPTYAEGSARASGQPLEDTTAAQL
FT                   ADWSAHLPALGAAVSPEVTPNLRSYGESWTERDLVAIPEQDLPPGAPAWWRAVDAWAVR
FT                   DGADAQEKRATIRVAVPKGARSWPTL"
     atggtcacgc accgaagctg cccgggttac gtcgacgagc cgttcgcctc gctcgtcgcg        60
     gactatcccg gggccgaggc ctatccaccg ggggacttcc gcgtcgagtg ggggccggtg       120
     ttccaccggg gccggctcga cgggtcggcc cgcgtgctcg tcatcggcca ggacccggcg       180
     acgcacgagg cgatcagccg ccgcgtcctc gtcggtgagg ccgggcagcg cgtgcagggg       240
     ctgctcgcgc ggctggggat cacccacagc tacgtcatgc tcaacgtcta cctctacagc       300
     gtcttcgggc aggcggccgg ctaccgacac gtgaaggacc cggacatcgt cgactaccgg       360
     caccgatggc tcgacgcggt cctgctcgac tccgcgtccc catccgtgac cccatccgtg       420
     accccttccg tgaccccttc cgtgacccca tccgtgaccc catccgtggc ctcctccggg       480
     gtcaccgcgg tcatcgccct gggcaccctc gccaagcggg cgttcggtct ctgggaggac       540
     agctcgcccg agcgggaggc acgctcccgc cggctccacc tcgcggcggt gcgtcacccc       600
     acgtatgccg aagggtcggc gcgggcgagt ggacagccct tggaggacac gactgccgcc       660
     cagctcgccg actggagtgc ccacctccct gcgctcggcg ccgccgtgtc tcccgaggtc       720
     accccgaacc tgaggtcgta cggcgagtcg tggaccgagc gcgacctggt ggcgatcccg       780
     gagcaggacc tccccccggg cgctcccgcc tggtggcgcg ccgtcgacgc gtgggcggtc       840
     cgggacggag ccgatgcgca ggagaagcgt gcgacgatcc gggtcgccgt cccgaaggga       900
     gcgcgatcat ggccgaccct ctga                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page