(data stored in ACNUC7421 zone)

EMBL: CP002343.PE196

CP002343.PE196       Location/Qualifiers
FT   CDS_pept        215076..216473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0200"
FT                   /product="amidohydrolase"
FT                   /note="COGs: COG0402 Cytosine deaminase and related
FT                   metal-dependent hydrolase; InterPro IPR006680; KEGG:
FT                   bja:blr0249 hypothetical protein; PFAM: amidohydrolase;
FT                   SPTR: Amidohydrolase; PFAM: Amidohydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46758"
FT                   /db_xref="GOA:E6S618"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E6S618"
FT                   /protein_id="ADU46758.1"
FT                   /translation="MADPLRTGPAPGRVTFEEAYSRGITDELPPPPRRARALPPTPFAL
FT                   RGAVITPQGAWSSGYVTVADGRIDRVSRRRPTSVPVLETDGVILPGLLDLHGHPEFNVF
FT                   AAWEPPKLYPNRYAWRRSTAYKQLVRDPQNALLSTVPPQTQTRYAEVRALVGGVTGIQG
FT                   AASASSSASAEPLVRNIDRWAFGAHRARSLVDLPTGSFGKESFDRIMAHIAAGTVNAFY
FT                   LHLSEGRRGDAVSTEEFRRFVDLGAATPATNIIHGSALTVTDLHEVADAGCRLVWSPQS
FT                   NLRLYGETTLAGEALRAGVPVALGADWLPSGSTSLLAEMKVARRELARQEHPVAAADLV
FT                   AMVTSVAARVAGLDEHLGSVAVGRPADLLVLERHHRDPYESVCLADPSWVELVCIGGDV
FT                   TYGRVDWFDELSGGAVGSTVEDLVAWGKPMRLDTGFQSPASGATPSLTEIRALLTAAYP
FT                   PVGPIFA"
     atggccgacc ctctgaggac gggacccgcg ccgggcaggg tcaccttcga ggaggcctac        60
     agcaggggga tcaccgacga gctgccgccg ccaccgcggc gagcgcgcgc cctgcccccc       120
     actccgttcg cgctccgggg cgccgtcatc acgccgcagg gtgcgtggtc ctcgggctac       180
     gtcaccgtcg cggacgggcg catcgaccgg gtcagccgcc gacgcccgac ctcggtcccg       240
     gtgctcgaga ccgacggggt catcctgccc gggctcctcg acctccacgg ccacccggag       300
     ttcaacgtct tcgccgcctg ggagccgccg aagctctatc cgaaccggta tgcgtggcgg       360
     cgctcgacgg cctacaagca actggtcagg gacccccaga acgccctgct gagcacggtc       420
     ccaccgcaga cgcagacgcg ctatgccgag gtgcgcgcgc tcgtcggcgg cgtgaccggg       480
     atccagggcg ccgcatcggc gagcagcagc gcctcggccg agcccctcgt gcgcaacatc       540
     gaccggtggg ccttcggcgc ccaccgggcc cgctcgctgg tcgacctgcc gaccgggagc       600
     ttcggcaagg agtcgttcga ccggatcatg gcgcacatcg ccgccggcac ggtcaacgcc       660
     ttctacctcc acctgtccga gggtcggcgc ggggacgcgg tgagcaccga ggagttccgc       720
     cggttcgtcg acctcggggc ggccaccccg gcgaccaaca tcatccacgg cagcgccctg       780
     acggtgaccg acctccacga ggtcgccgac gccggctgcc gcctcgtgtg gtcgccccag       840
     tcgaacctcc gcctctacgg cgagacgacc ttggccgggg aggccctccg ggccggtgtc       900
     cccgttgccc tcggtgcgga ctggctgccc tcgggctcga cgagcctgct ggccgagatg       960
     aaggtcgccc ggcgcgagct cgcccggcag gagcaccccg tcgcggccgc tgacctcgtc      1020
     gccatggtga cgtcggtggc ggcccgggtg gccgggctcg acgagcacct cgggtccgtc      1080
     gcggtgggac gccccgccga cctcctcgtc ctggaacggc accaccgcga tccctacgag      1140
     agcgtctgcc tcgccgaccc gtcgtgggtc gagctcgtct gcatcggtgg tgacgtcacc      1200
     tacggccggg tcgactggtt cgacgagctg tccggtggcg cggtggggtc gacggtcgag      1260
     gacctcgtgg cctggggcaa gccgatgcgg ctcgacaccg gcttccagtc gccggccagt      1320
     ggggcgacac cgtcgctcac cgagatccgg gccctgctga cggcggccta cccgcccgtg      1380
     ggtccgatct tcgcctga                                                    1398
//

If you have problems or comments...

PBIL Back to PBIL home page