(data stored in ACNUC7421 zone)

EMBL: CP002343.PE198

CP002343.PE198       Location/Qualifiers
FT   CDS_pept        217202..218068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0202"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="COGs: COG0566 rRNA methylase; InterPro IPR013123:
FT                   IPR001537; KEGG: kse:Ksed_01710 rRNA methylase; PFAM:
FT                   tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase substrate binding; SPTR: Putative rRNA
FT                   methylase; PFAM: SpoU rRNA Methylase family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46760"
FT                   /db_xref="GOA:E6S620"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:E6S620"
FT                   /protein_id="ADU46760.1"
FT                   /translation="MNLPRDLSVSSPSNPRLKALVALRRRRVREETGQTIVEGHEEIRL
FT                   ALDAGVTPRTLYVAEELFSPSGRAGSQEIGTQPELVERLRAAGVEIVRLSPAAYAKVSY
FT                   REGPDGLLAVVDDVGVPLASLTVDGPSWLGLVAQRIEKPGNLGAMLRTADAAGVDAVVA
FT                   ADPVTDWGNPNVVRASKGTLFAVPVASGTTSETLAWLAHGAVTLVVTTPETDLLHTEVD
FT                   YTGRVAIAVGSEKHGVDDALLVAATHRVRIPMHGRANSLNVSVAAAVVLYEAVRQRASR
FT                   LGGGGPA"
     atgaacctgc ctcgcgacct ctccgtgtcc tccccgtcga acccccgcct caaggcgctc        60
     gtcgcgctgc gccgccggcg ggtccgggag gagaccggcc agaccatcgt cgaggggcac       120
     gaggagatcc ggttggcact cgatgccgga gtcacccccc ggacgctcta cgtggcggag       180
     gagctgttca gcccgtcggg ccgcgccggg tcacaggaga tcggcacgca accggagctc       240
     gtcgaacgac tccgagcggc aggggtcgag atcgtccgac tcagcccagc ggcatacgcc       300
     aaggtgtcct atcgggaagg gcccgacggc ctgctggccg tcgtcgacga cgtcggtgtg       360
     ccgctggcct cgctcacggt cgacggtccc tcgtggctcg ggctcgtcgc gcagcggatc       420
     gagaagcccg ggaacctcgg ggcgatgctg cgcacggcgg acgcagccgg cgtcgacgcg       480
     gtcgtcgccg cggaccccgt cacggactgg ggcaacccca acgtcgtccg agcgagcaag       540
     ggcaccctct tcgccgtgcc ggtcgcgagc gggacgacgt ccgagaccct cgcctggctg       600
     gcgcacggcg ccgtcaccct ggtcgtgacc accccggaga ccgacctcct ccacaccgag       660
     gtggactaca ccggccgggt ggccatcgcg gtcggctccg agaagcacgg cgtcgacgac       720
     gcgctcctcg tggccgccac ccatcgggta cgcatcccga tgcacggccg cgcgaacagc       780
     ctcaacgtct cggtcgccgc cgccgtcgtc ctctacgagg cagtccggca acgtgcctca       840
     cgcctcggag gtggcggtcc ggcctga                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page