(data stored in ACNUC7421 zone)

EMBL: CP002343.PE199

CP002343.PE199       Location/Qualifiers
FT   CDS_pept        218117..218752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0203"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kse:Ksed_01720 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46761"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:E6S621"
FT                   /protein_id="ADU46761.1"
FT                   /translation="MRVDHVSYAAEHDGLQATAERLSKLLGVEPVDGGVHPRFGTRNVI
FT                   LPLADRNYVEVVEVLDHPASDKAPFGQAVRARSEAGGGWLGWVVAVDDLTAAEKRLGRE
FT                   AVEGNRHRPDGTELRWRQIGIRGLIADPQVPYFIQWEDISLHPANGSAAQVHIGELQIA
FT                   GDPARVREWLGVDQTFDKGDIHFTFVAPHGTPGLLSVTFHTPDGDVTI"
     atgcgagtcg accacgtgtc ctatgcggca gagcacgacg gcctccaggc aacggccgag        60
     aggctctcga agctccttgg tgtggagccc gtcgacggcg gggtccaccc ccggttcggg       120
     acgcgcaacg tcatccttcc cctcgcggac cgcaactacg tcgaggtcgt cgaggtgctc       180
     gatcaccccg cctcggacaa ggcccccttc gggcaggcgg tccgggcgcg ctcggaggcc       240
     ggcggtggct ggctcgggtg ggtcgtcgcc gtggacgacc tgaccgccgc ggagaagcga       300
     ctcggccgcg aggccgtgga gggcaaccgg caccgtcccg acggcaccga gctgcgctgg       360
     cggcagatcg gcatcagggg actcatcgcc gacccccagg tcccctactt catccagtgg       420
     gaggacatct cgctccaccc ggccaacggc tccgcggcgc aggtgcacat cggcgagctg       480
     cagatcgccg gcgacccggc gcgcgtgcgt gaatggctcg gcgtcgacca gaccttcgac       540
     aagggcgaca tccacttcac cttcgtcgcg ccgcacggca cccccgggct gctgtccgtc       600
     acgttccaca ccccggacgg cgacgtcacg atctga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page