(data stored in ACNUC7421 zone)

EMBL: CP002343.PE20

CP002343.PE20        Location/Qualifiers
FT   CDS_pept        complement(22375..22833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0020"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmi:MMAR_4843 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46582"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDX9"
FT                   /protein_id="ADU46582.1"
FT                   /translation="MAIARKLKISHDEVFPHGAYLVSEVTPVVDYDRSTKDNKVQQLDK
FT                   ETGLPMWTVDVLDADPEATKKNRTVSVKLIAKVQPVPPASDGSSPFTRVVFDGLTATPW
FT                   TDTSKCKPPEPGRGHRCGAQNAWSLRADGMSAPGKSAPAPNPSPNKAA"
     atggccatcg cacgcaagct caagatcagc cacgacgagg tgttcccgca tggggcgtac        60
     ctagtctccg aggtcacgcc ggtcgtcgac tacgaccgct cgaccaagga caacaaggtc       120
     cagcagctcg acaaggaaac cggcctgccg atgtggaccg tcgacgtcct cgacgccgac       180
     ccggaggcca ccaagaagaa ccgcaccgtg tcggtcaagc tcatcgccaa ggtgcagcct       240
     gtgccgccgg cgtccgacgg atcctcgccg ttcacccgcg tcgtgttcga cggcctgacg       300
     gccacgccgt ggacggacac ctcgaagtgc aagccgccgg agccgggtcg cggtcaccgt       360
     tgcggcgcac agaacgcctg gtcgctccgg gccgacggca tgtccgcgcc tggcaagtct       420
     gcgccggcgc cgaatcccag cccgaacaag gccgcctga                              459
//

If you have problems or comments...

PBIL Back to PBIL home page