(data stored in SCRATCH zone)

EMBL: CP002343.PE200

CP002343.PE200       Location/Qualifiers
FT   CDS_pept        complement(218742..220340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0204"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="COGs: COG2217 Cation transport ATPase; InterPro
FT                   IPR005834; KEGG: mmi:MMAR_0231 cation transporter p-type
FT                   ATPase CtpA_1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; SPTR: Cation-transporting P-type ATPase; PFAM:
FT                   haloacid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46762"
FT                   /db_xref="GOA:E6S622"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E6S622"
FT                   /protein_id="ADU46762.1"
FT                   /translation="MQGRDDRSPRADELLTKLRRRAEALGSAGAAPGEDEHPAAALPPP
FT                   GARTRLLVALVLTVPVVALALWANDSTVGRWAQVVLTAVILGWSAGPLVAAAGRTLRAL
FT                   RPGPEVPVLLGALVSWAASVTDLVRGAPEQWFGAAAVAATLLLLVRHVAARAHAAAGPD
FT                   MPQPTVVDRLARWLPPVVLLVAAVVLVVRLRTGHTVADSLSATVAVLFIASLPAAALAA
FT                   PAALAAARARAERRLGSAPAAGTLARSATLDTVVINRTGLLTTGDLALRKIAVTGRLSK
FT                   KAALIAAAAVEQGSDHPIARAIVAGAGQARVDLPRIRDFEANPGEGASARIKDTEVTVG
FT                   KAALFEHVDPDLLAHADGTPGRTVFVGWGGRARAALTVEDTIRETSRPAIARLKGLGLT
FT                   PYLLTEDGEAHARGLAAAVGIDPGKVRSGSRGKAVTDRDLVSELQRQGRRVAVIGRAPA
FT                   DLLFEADDVDAAADTIELAQQTQSVIRQHLGWALGYNVIALVAGGLGWVHPTWAAILAA
FT                   VAAFVPLASAQRLRS"
     atgcagggcc gagacgaccg gagtcctcgg gccgacgagc tgctgacgaa gctgcgccgt        60
     cgcgccgagg ccttgggcag cgccggtgca gcgccgggcg aggacgagca ccctgccgcc       120
     gcactcccgc cgccgggggc gcgcactcgg ctcttggtcg ccctcgtcct gaccgttccc       180
     gtggtcgcac tggcgctctg ggcgaacgac agcacggtcg gacgctgggc ccaggtggtc       240
     ctgaccgcgg tcatcctcgg ctggtccgcc ggcccgctgg tcgcggcggc agggcgcacg       300
     ctgagggccc tcagaccggg gccggaggtg ccggtcctgc tcggcgccct ggtctcgtgg       360
     gcggcgtccg tgaccgacct ggtccgcggc gctccggagc agtggttcgg agccgctgcc       420
     gtcgccgcga ccctcctcct gctcgtccgc cacgtcgcgg cccgcgccca cgcagccgcc       480
     gggccggaca tgccgcagcc gaccgtcgtg gaccgcctcg cgaggtggct gcccccggtc       540
     gtcctcctcg tcgcggcggt cgttctcgtc gtccggctcc gcaccggaca caccgtggcg       600
     gactcgctca gcgcgacggt cgcggtcctg ttcatcgcgt cgttgccggc cgccgccctg       660
     gctgcgccgg cagccctggc cgcggcccgg gcgcgggccg agcgccggct ggggtcggcg       720
     ccggctgccg gcaccctggc gaggtcggcc acccttgaca ccgtcgtcat caaccgcacg       780
     gggctgctga cgaccggcga cctcgccctg cggaagatcg cggtcaccgg tcggctgtcc       840
     aagaaggcgg cgctcatcgc cgccgccgcg gtcgagcagg gcagcgacca cccgatcgcc       900
     cgggccatcg tcgcgggggc ggggcaggcc cgggtcgacc tgccgcggat ccgcgacttc       960
     gaggccaatc cgggcgaagg ggcgtccgcg cggatcaagg acaccgaggt caccgtcggc      1020
     aaggccgccc tcttcgaaca cgtcgacccg gacctgctcg cccatgcgga cgggaccccg      1080
     ggccggacgg tgttcgtcgg ctggggcggc cgggcccgcg cggcactcac cgtcgaggac      1140
     acgatccggg agacgtcccg gcccgcgatc gcgcggctca agggcctcgg cctgacgccc      1200
     tacctgctca ccgaggacgg ggaagcgcac gctcgaggcc ttgccgccgc ggtgggcatc      1260
     gacccgggga aggtccggtc cggatcgcgc ggcaaggccg tcacggatcg ggacctggtc      1320
     tccgagctgc agcggcaggg gcgccgggtc gccgtcatcg ggcgggcgcc ggcagacctg      1380
     ctcttcgagg ccgacgacgt cgacgcggcg gcggacacca tcgagctggc ccagcagacc      1440
     cagtcggtga tccggcagca cctcggctgg gcgctcggct acaacgtgat cgccctcgtc      1500
     gctggtggcc tgggctgggt ccacccgacg tgggccgcga tcctcgccgc ggtggccgcg      1560
     ttcgttccgc tcgccagtgc gcagcgtctc agatcgtga                             1599
//

If you have problems or comments...

PBIL Back to PBIL home page