(data stored in ACNUC7421 zone)

EMBL: CP002343.PE203

CP002343.PE203       Location/Qualifiers
FT   CDS_pept        221510..222451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0208"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_0019 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46765"
FT                   /db_xref="UniProtKB/TrEMBL:E6S625"
FT                   /protein_id="ADU46765.1"
FT                   /translation="MTTVTRIVGFALGLVVVFVLALGLGRVVGPVGEPPAAHAGSSGGG
FT                   AGSADLPAAGLPGGLTISDAGYTLRLSAPTAPAGRGVPVSFAVTGPDGTPVTDYEVEHE
FT                   KELHLIAVRRDFTGYQHVHPTLRADGTWSAALDLEPGVWRLFADFTATGAGALTLGTDL
FT                   SVPGTAALAAPVGETRTVTVDGYTVSITGDLVAGQDADLSFSVRKDGAPVADLQPYLGA
FT                   YGHLVALRQGDLAYLHVHPDGAPGDGRTRPGPDVVFHASVPSAGAYRLYLDFQHDGVVR
FT                   TAPLSVTAHGSAAPAEPAPASSGTTSDHGDDH"
     atgaccacag tcaccaggat cgtcggcttc gccctcggcc tggtcgtcgt cttcgtgctc        60
     gccctcgggc tcggccgcgt ggtcgggccc gtgggggagc caccggcggc gcacgccggc       120
     tcgagcgggg gtggcgcggg cagtgctgac ctgccggcgg ccggactccc gggcggcctc       180
     acgatcagcg acgccggcta caccctgcgc ctctcggcgc cgaccgctcc ggccgggcgg       240
     ggcgtgcccg tgtcgttcgc cgtcaccggc ccggacggca cgccggtgac cgactacgag       300
     gtcgagcacg agaaggagct gcacctcatc gcggtgcggc gcgacttcac cggctaccag       360
     cacgtccacc cgacgctgcg cgccgacggc acgtggtcag cggcgctcga cctcgagcct       420
     ggcgtgtggc gtctcttcgc cgacttcacc gcgaccggcg ccggcgccct gaccctcggg       480
     accgacctca gcgtcccggg gacggcggcc ctcgcggctc ccgtcggcga gacccgaacc       540
     gtcaccgtcg acggctacac ggtcagcatc accggcgacc tcgtcgccgg ccaggatgcc       600
     gacctcagct tctcggtccg caaggacggc gcacccgtcg ccgacctcca gccgtacctc       660
     ggcgcctacg gccacctggt cgcgctccgc cagggcgacc tcgcctacct ccacgtccac       720
     ccggacggag cccccgggga cggacgcacc agacccggcc ccgacgtcgt cttccacgcg       780
     tccgtgccga gtgccggcgc ctaccggctg tacctcgact tccagcacga cggggtcgtg       840
     cggaccgcgc cgctctcggt caccgcgcac ggcagcgccg cgccggcaga accggccccc       900
     gcctccagcg gcacgacctc agaccacgga gatgaccact ga                          942
//

If you have problems or comments...

PBIL Back to PBIL home page