(data stored in ACNUC7421 zone)

EMBL: CP002343.PE204

CP002343.PE204       Location/Qualifiers
FT   CDS_pept        222451..224775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0209"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="COGs: COG2217 Cation transport ATPase;
FT                   InterProIPR006121: IPR008250: IPR005834: IPR006403: IPR
FT                   006416: IPR001757: IPR018303: IPR017969: IPR000150:
FT                   IPR000695; KEGG: rop:ROP_pROB01-02380 putative
FT                   copper-transporting ATPase CopA; PFAM: E1-E2
FT                   ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase; SPTR: Putative
FT                   copper-transporting ATPase CopA; TIGRFAM: heavy metal
FT                   translocating P-type ATPase; copper-translocating P-type
FT                   ATPase; ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC; PFAM: E1-E2 ATPase; Heavy-metal-associated
FT                   domain; haloacid dehalogenase-like hydrolase; TIGRFAM:
FT                   copper-(or silver)-translocating P-type ATPase; heavy metal
FT                   translocating P-type ATPase; ATPase, P-type (transporting),
FT                   HAD superfamily, subfamily IC"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46766"
FT                   /db_xref="GOA:E6S626"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E6S626"
FT                   /protein_id="ADU46766.1"
FT                   /translation="MTTTPTTTPGGASLGLPSAPGAIELEITGMTCASCANRIERKLNK
FT                   LDGVTATVNYATEKAKVSFPDTLSAEELVKAVEAAGYGATVPAPPVTAEGAEGPSGGEA
FT                   SPAAYDRVRALRDRLVVSAVLSLPVIAMAMVSALQFDYWQWASLTLAAPVVVWGAWPFH
FT                   KAAWTNLRHGTTTMDTLVSMGVLAAFGWSLYALFLGTAGMPGMVHPFELTISRTDGAGN
FT                   IYLEAAAGVTTFLLAGRYFEARSKRQAGAALRALLELGAKDVSVLRDGLSGQVEERIPT
FT                   SQLQVGMRFVVRPGEKIATDGVVEDGTSAVDAAMLTGESVPVEVGPGSAVAGATINAGG
FT                   RIVVRATRVGSDTQLAQMARLVEDAQNGKAQVQRLADRISGFFVPIVIGLSAATLGFWL
FT                   GTGAGAAAAFTAAVAVLIIACPCALGLATPTALMVGTGRGAQLGILIKGPEVLESTRQV
FT                   DTIVLDKTGTVTTGAMALHAVVAADGEDEAEVLRLAGAVEDASEHPVARAVAAGAKERL
FT                   GALPAVSGFESTQGLGVRGEVDGSDVYVGRPVFLAERRQMRCTELDAAATEHESQGSTV
FT                   VAVAWGGRMRGILVVADTIKTTSAQAIQELRDLGLTPILLTGDNERVARTVAAQVGIAE
FT                   ADVIADVLPADKVDVVKRLQESGKVVAMVGDGVNDAAALAQADLGLAMGTGTDVAIEAS
FT                   DLTLVRGDLRVAADAIRLARRTLRTIKGNLFWAFAYNVAAIPLAAAGLLNPMLAGAAMA
FT                   FSSVFVVSNSLRLRGFRATAA"
     atgaccacga cgccgacgac cacaccgggg ggcgcctcgc tcggcctgcc ctcggcaccc        60
     ggggcgatcg agctcgagat caccggcatg acgtgcgcct cgtgcgccaa ccggatcgag       120
     cgcaagctca acaagctcga cggcgtgacg gccacggtca actacgccac cgagaaggcc       180
     aaggtctcct tccccgacac gctctccgcc gaggagctcg tcaaggccgt cgaggccgcc       240
     ggctacggcg cgacggtccc cgcgccaccg gtgacagcgg aaggcgcgga aggtccctcc       300
     ggcggggaag cgagcccagc ggcgtacgac cgcgttcgtg ctctgcgtga ccgactggtc       360
     gtctcggcgg tgctcagcct ccccgtcatc gccatggcga tggtctcggc cctgcagttc       420
     gactactggc agtgggcctc gctcaccctc gcggccccgg tcgtcgtgtg gggcgcctgg       480
     ccgttccaca aggccgcgtg gaccaacctc cggcacggca cgacgacgat ggacaccctc       540
     gtctccatgg gggtgctcgc ggccttcggc tggtcgctct atgccctctt cctcgggacc       600
     gccgggatgc ccgggatggt ccacccgttc gagctgacca tctcgcgcac cgacggcgcg       660
     ggcaacatct acctcgaggc cgcggccggg gtgacgacct tcctcctcgc cggccgctac       720
     ttcgaggcac ggtccaagcg gcaggccgga gcggctctgc gcgcgctcct cgagctcggc       780
     gccaaggacg tgtcggtcct gcgggacggg ctctcgggtc aggtcgagga gcggatcccg       840
     acctcgcagc tccaggtcgg gatgcggttc gtcgtccggc cgggggagaa gatcgccacc       900
     gacggcgtcg tcgaggacgg cacctcagcc gtcgacgccg cgatgctcac gggcgagtcc       960
     gtgcccgtcg aggtcggtcc cggctccgcg gtcgccggag cgacgatcaa cgccggcggc      1020
     cgcatcgtcg tccgggccac acgcgtcggc tccgacaccc agctcgccca gatggcgcga      1080
     ctcgtcgagg acgcccagaa cggcaaggcc caggtccagc ggctcgccga ccggatctcc      1140
     gggttcttcg tgcccatcgt catcggcctg tcggcggcca cgctcggctt ctggctcgga      1200
     acgggcgcgg gcgccgcggc cgccttcacc gcggccgtcg ccgtgctcat catcgcctgc      1260
     ccgtgcgccc tcggcctcgc gacacccacc gcgctcatgg tcgggaccgg ccgtggcgcg      1320
     cagctcggca tcctcatcaa ggggccagag gtgctcgagt ccacccgcca ggtcgacacg      1380
     atcgtcctcg acaagacagg cacggtcacg accggggcca tggcgctcca cgccgtcgtc      1440
     gccgccgacg gtgaggacga ggcggaggtg ctgcgcctgg ccggtgccgt cgaggacgcc      1500
     tcggagcacc ccgtcgcccg cgccgtcgcg gctggcgcga aggagcggct cggggcgctg      1560
     cccgccgtgt cgggcttcga gagcacgcag ggtctcggcg tgcgcggcga ggtcgacggc      1620
     agcgacgtct acgtcggccg ccccgtgttc ctcgccgagc gtcggcagat gcgctgcacc      1680
     gagctcgatg cggctgccac ggagcacgag tcccagggct cgaccgtggt cgcggtggcg      1740
     tggggcggac ggatgcgcgg catcctcgtc gtcgccgaca ccatcaagac gacctcggcg      1800
     caggccatcc aggagctgcg cgacctcggc ctcaccccga tcctgctcac cggcgacaac      1860
     gagcgcgtcg cgcggaccgt cgccgcccag gtcggcatcg ccgaggccga cgtcatcgcc      1920
     gacgtcctgc ccgccgacaa ggtcgacgtc gtcaagcggc tccaggagtc cggcaaggtc      1980
     gtcgccatgg tcggcgacgg ggtcaacgac gccgcggccc tggcccaggc cgacctcggc      2040
     ctcgccatgg gcaccggcac cgacgtcgcg atcgaggcga gcgacctgac cctcgtgcgc      2100
     ggggacctgc gcgtcgcggc cgatgcgatc cgcctggccc gacgcaccct ccggacgatc      2160
     aagggcaacc tcttctgggc gttcgcctac aacgtcgccg cgatcccgct ggccgcggcc      2220
     ggcctgctca accccatgct cgccggggcc gcgatggcgt tctcgtcggt gttcgtcgtg      2280
     tccaactcgc tgcggctgag gggcttccgg gcgactgcgg cctga                      2325
//

If you have problems or comments...

PBIL Back to PBIL home page