(data stored in ACNUC7421 zone)

EMBL: CP002343.PE205

CP002343.PE205       Location/Qualifiers
FT   CDS_pept        complement(224946..226355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0210"
FT                   /product="Adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /note="COGs: COG0015 Adenylosuccinate lyase; InterPro
FT                   IPR000362: IPR013539: IPR004769: IPR020557; KEGG:
FT                   kse:Ksed_01820 adenylosuccinate lyase; PFAM:
FT                   Adenylosuccinate lyase domain-containing protein; fumarate
FT                   lyase; SPTR: Adenylosuccinate lyase; TIGRFAM:
FT                   adenylosuccinate lyase; PFAM: Lyase; Adenylosuccinate lyase
FT                   C-terminal; TIGRFAM: adenylosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46767"
FT                   /db_xref="GOA:E6S627"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR013539"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:E6S627"
FT                   /protein_id="ADU46767.1"
FT                   /translation="MASLAAATPPIALGALDGRYRAAVAPLVDHLSEAALNRERVRVEV
FT                   EWLIHQTSHGIVPGVRRLTDAEISALRGLVETFGPVEVAELAEIERVTVHDVKAVEYFL
FT                   KRRLAEIAPAEEDKGLAELVHFGCTSEDINNLAYALMVKGAVADVWLPRAQALVEQVSA
FT                   LARDLRDVPLLAHTHGQPATPTTMGKELAVLAFRLGRQLRRVDRQEYLGKFNGATGTFG
FT                   AHALALPDVDWPTVSREFVEGLGLTWNPLTTQIESHDWQAELYADVARFNRVLHNLCTD
FT                   VWTYISMGYFAQVRGQGTVGSSTMPHKVNPIRFENAEANLEVGNALLDVLGSTLVQSRL
FT                   QRDLTDSSMQRNIGSAFGHSLLALDNVARGLAGLDAVPSAMAADLESNWEVLGEPIQSA
FT                   MRALGARGVPGMEEPYERLKELTRGRRVGGDEVREFVRGLGLPADVEERFLALTPQTYT
FT                   ALASRLVDYLP"
     atggcctccc tcgctgccgc aacacccccc atcgcgctcg gcgcgctcga cgggcgctac        60
     cgtgccgccg tcgccccgct cgtcgaccac ctctcggagg ccgcactcaa ccgggagcgg       120
     gtgcgcgtcg aggtggagtg gctgatccac cagacgtccc acggcatcgt ccccggggtc       180
     cgccggctga ccgacgcgga gatctcggcg ctgcgcggcc tcgtcgagac gttcgggccg       240
     gtcgaggtgg ccgagctcgc cgagatcgag cgggtcaccg tgcacgacgt caaggcggtc       300
     gagtacttcc tcaagcgccg cctcgccgag atcgctcccg ccgaggagga caagggtctc       360
     gctgagctgg tccacttcgg ctgcacgagc gaggacatca acaacctcgc ctacgccctg       420
     atggtcaagg gcgccgtggc ggacgtctgg ctgccccggg cacaggccct cgtcgagcag       480
     gtctccgcgc tggcccgcga cctccgggac gtgccgctgc tcgcacacac ccacggccag       540
     ccggccaccc cgacgaccat gggcaaagag ctggccgtgc tcgcgttccg actgggccgg       600
     cagctgcgcc gggtcgaccg gcaggagtac ctcggcaagt tcaacggggc caccggcacg       660
     ttcggcgccc acgccctcgc gctgcccgac gtcgactggc cgaccgtgtc gcgcgagttc       720
     gtcgaagggc tcgggctcac ctggaacccg ctgacgaccc agatcgagag ccacgactgg       780
     caggccgagc tctacgccga cgtcgcgcgc ttcaaccggg tcctgcacaa cctctgcacg       840
     gatgtgtgga cgtacatctc gatgggctac ttcgcgcagg tccgcgggca ggggacggtc       900
     ggctcgagca cgatgcccca caaggtcaac ccgatccgct tcgagaacgc cgaggcgaac       960
     ctcgaggtcg gcaacgcgct cctcgacgtc ctcgggtcga ccctcgtcca gagccggctg      1020
     cagcgtgacc tcaccgactc gtcgatgcag cgcaacatcg ggtcggcctt cggacacagc      1080
     ctcctcgcgc tcgacaacgt ggcgcgggga ctggccgggc tcgacgccgt cccgtcggcg      1140
     atggcggccg acctcgagtc gaactgggag gtcctcggcg agccgatcca gtcggcgatg      1200
     cgggcgctgg gagcgcgggg cgtgccgggc atggaggagc cgtacgagcg gctcaaggag      1260
     ctgacgcggg gccgccgggt cgggggcgac gaggtccgcg agttcgtccg tgggctcggg      1320
     ctgccggctg acgtcgagga gcggttcctc gcgctgacgc ctcagaccta cacggcgctg      1380
     gcgagccggt tggtcgacta cctgccctga                                       1410
//

If you have problems or comments...

PBIL Back to PBIL home page