(data stored in ACNUC7421 zone)

EMBL: CP002343.PE206

CP002343.PE206       Location/Qualifiers
FT   CDS_pept        complement(226547..227338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0211"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="COGs: COG3324 protein related to lactoylglutathione
FT                   lyase; InterPro IPR004360: IPR013838; KEGG: amd:AMED_0924
FT                   glyoxalase/bleomycin resistance protein/dioxygenase; PFAM:
FT                   Glyoxalase/bleomycin resistance protein/dioxygenase; SPTR:
FT                   Glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46768"
FT                   /db_xref="GOA:E6S628"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:E6S628"
FT                   /protein_id="ADU46768.1"
FT                   /translation="MRDLHVTVPHYPYGAPCWVDLLVSDVGRAQHFYSELFGWRWLTGD
FT                   AASGGYTMALLADQPVAGISRRPPTAPVPSQWTTYLRVGDITVAAQAIATYGGRPLGRP
FT                   VQIGALARTMVAVDPGGAYFGVWEPGDLPGSGTLDQPGSLTWNELLTRDYDVVLDFYEN
FT                   IFAHGFIDETENGGPRWSTAHTGDGNPAYGLAEIEADWPPEIPAHWVAHFATDSVVTTV
FT                   AHALDLGGTLLQGPFDGPFGLGAVLSGPEGEVFSVLVPELD"
     atgagagacc tccacgtgac cgttccgcac tacccctatg gggccccctg ctgggtggac        60
     ctcctggtca gcgacgtcgg ccgggcccag cacttctaca gcgagctgtt cggctggcgc       120
     tggttgacgg gcgacgcggc cagcgggggc tacaccatgg cgctgctcgc ggaccagccc       180
     gtcgccggaa tcagccgccg gcccccgacc gccccggtgc cgagccagtg gacgacctac       240
     cttcgcgtcg gcgacatcac cgtcgcggcg caggccatcg ccacctacgg gggacgcccc       300
     ctcggccgcc ccgtccagat cggggcgctg gcacgcacca tggtcgcggt cgacccgggg       360
     ggcgcctact tcggggtgtg ggagccgggc gacctgcccg gcagcggcac cctcgaccag       420
     ccgggctccc tgacctggaa cgagctgctg acccgcgact acgacgtggt gctcgacttc       480
     tacgagaaca tcttcgccca cggcttcatc gacgagaccg agaacggcgg cccccgctgg       540
     tcgacggccc acaccggtga cggcaaccct gcgtacggcc tggccgagat cgaggccgac       600
     tggccgcccg agatcccagc gcactgggtg gcccacttcg ccacggacag cgtcgtgacc       660
     accgtcgccc acgcgctcga cctcggcggc acgctgctcc aaggaccctt cgacggaccc       720
     ttcggcctcg gtgcggtgct cagcggcccc gagggagagg tgttctcggt cctcgtcccc       780
     gagctggact ga                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page