(data stored in ACNUC7421 zone)

EMBL: CP002343.PE208

CP002343.PE208       Location/Qualifiers
FT   CDS_pept        227937..228362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0213"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mlo:mlr0593 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46770"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:E6S630"
FT                   /protein_id="ADU46770.1"
FT                   /translation="MTTTRGARTPRELLSAFVGRVAAGDVAGIAGAYAADAVVSLPRGR
FT                   EAAGSQAIERAYAAALAGGALLAVGRPDDAAALELLVESARVIETGPLSMVSFTGADGA
FT                   VRTMVAWQGEDGWAWVRDGSMLRDVEAALGAGLSDVA"
     atgacgacga cccgtggtgc gaggaccccc cgagagctgc tgtccgcctt cgtgggacgg        60
     gtggcggccg gtgacgtggc cgggatcgcc ggggcgtatg ccgctgacgc cgtcgtcagc       120
     ctgccgcgcg gtcgggaggc ggccggctcc caggcgatcg agcgtgccta cgcggccgcg       180
     ctggccgggg gtgcgctcct cgccgtgggc cggcccgacg atgcggccgc cctcgagctg       240
     ctcgtcgagt ccgctcgggt catcgagacc ggtccgctgt cgatggtctc gttcacgggc       300
     gccgacggtg cggtccggac gatggtggcc tggcagggcg aggacggctg ggcctgggtc       360
     cgcgacgggt cgatgctccg cgacgtcgag gccgcgctcg gggcgggcct gtccgacgtg       420
     gcgtag                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page