(data stored in ACNUC7421 zone)

EMBL: CP002343.PE21

CP002343.PE21        Location/Qualifiers
FT   CDS_pept        23320..23652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0021"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_1746 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46583"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDY0"
FT                   /protein_id="ADU46583.1"
FT                   /translation="MNIDRMLGIAVRTSADFGDGAWTPGMPLQQGWLWAGTVEGDTVLA
FT                   FELGPGRVLFGFTPDELRSVRKVASGFNTVVECVVAEENGSPRTFTLVGPRGRIKKAFQ
FT                   HIGKPI"
     gtgaatatcg accggatgct cggcatcgcg gtgaggactt cggcggattt cggcgacggt        60
     gcctggacgc cggggatgcc cctccagcaa ggatggctgt gggccgggac ggtggagggc       120
     gacaccgtcc tcgcgttcga acttggcccg ggacgggtct tgttcggatt cactcccgac       180
     gagctcagat ccgtacgcaa ggtcgcgtcg ggcttcaaca cagtggtcga atgcgtggtt       240
     gcagaggaga acggctcgcc taggactttc accctagtgg ggccaagggg ccgaattaag       300
     aaggcattcc agcatatcgg gaaaccgatc tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page