(data stored in ACNUC7421 zone)

EMBL: CP002343.PE211

CP002343.PE211       Location/Qualifiers
FT   CDS_pept        complement(231164..232060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0216"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="InterPro IPR001915; KEGG: msm:MSMEG_3631 integral
FT                   membrane protein; PFAM: peptidase M48 Ste24p; SPTR:
FT                   Putative uncharacterized protein; PFAM: Peptidase family
FT                   M48"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46773"
FT                   /db_xref="GOA:E6S633"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:E6S633"
FT                   /protein_id="ADU46773.1"
FT                   /translation="MVIAALLTLTIALAWPVPRLMAGMTTFRRAPRAALVVWQSTTMGA
FT                   VLAALFAAPAALPYVIGPTAALADNATQIAVAVAVSGLIAGRLIVSGHRVGTRLRAHRR
FT                   RHRRLVDLLAVPVGADGSHAAHMRVIEHPTPTAYCVPGMRRRVVLTQGTLDSLPEDQLV
FT                   AVLAHERAHLRARHDLILEFFTVIHEAVPSWFRCEMAMHEVKLLIEVLADRAAVRATGV
FT                   VSTARAIVGMATGAVKPEGMLAMGESPSAARLRLELLQPGPVAGLPAGVAATVMYLFAT
FT                   SVVIMPVALLVVAWATA"
     atggtcattg cggccctgct caccctgacg atcgccctcg cgtggccggt gccgcgtctc        60
     atggctggca tgacgacgtt ccgacgcgcc ccgcgggccg ccctcgtcgt ctggcagtcg       120
     accacgatgg gggccgtgct ggccgccctc tttgccgcac ccgccgcgct gccctacgtc       180
     atcgggccga ccgccgcact cgctgacaac gccacccaga tcgcggtcgc cgtcgccgtg       240
     agcggtctca tcgcgggccg gctcatcgtc tccggccacc gggtcggcac ccggttgcgc       300
     gcccatcgcc ggcgccaccg gaggctcgtc gacctcctcg ccgtgccggt cggggcggac       360
     gggtcccacg ccgcgcacat gcgcgtcatc gagcacccga ccccgaccgc ctactgcgtg       420
     ccggggatgc gccgccgcgt cgtgctgacg caaggcaccc tcgactcgct ccccgaggac       480
     cagctcgtcg ccgtcctcgc ccatgagcgg gcgcacctgc gggcccggca cgacctcatc       540
     ctcgagttct tcacggtcat ccacgaggcc gtgcccagct ggttccggtg cgagatggcc       600
     atgcatgagg tcaagctgct catcgaggtg ctggccgacc gcgcggccgt gcgagccacc       660
     ggcgtcgtgt ccacggcccg cgccatcgtc gggatggcca ccggggccgt caagcccgag       720
     gggatgctcg cgatgggcga gtccccgtcg gcagcccggc tgcgactcga gctgctccag       780
     cccggacccg tcgcggggct gcccgccggg gtcgcggcga cggtgatgta cctcttcgcc       840
     acgtcggtcg tgatcatgcc ggtcgccctg ctcgtcgtcg cgtgggccac cgcctga          897
//

If you have problems or comments...

PBIL Back to PBIL home page