(data stored in SCRATCH zone)

EMBL: CP002343.PE212

CP002343.PE212       Location/Qualifiers
FT   CDS_pept        complement(232075..232488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0217"
FT                   /product="transcriptional repressor, CopY family"
FT                   /note="COGs: COG3682 transcriptional regulator protein;
FT                   InterPro IPR005650; KEGG: kse:Ksed_01860 predicted
FT                   transcriptional regulator; PFAM: Penicillinase repressor;
FT                   SPTR: Transcriptional regulator-like protein; PFAM:
FT                   Penicillinase repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46774"
FT                   /db_xref="GOA:E6S634"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6S634"
FT                   /protein_id="ADU46774.1"
FT                   /translation="MASNPPTRLGDLERAVMEHLWVSTEAHPEGLTVRDVHDAIGVTRG
FT                   LAYTTLMTVLDRMAKKQLVTRERDGRAWRYLPASSRDELTSEALHHTLGELAGSQRRSA
FT                   LLRFLDQSTPEELDELRAALADLEQREGTHQTG"
     atggccagca acccacccac ccgactcggt gacctcgagc gtgccgtcat ggagcacctc        60
     tgggtctcga ccgaggcgca ccccgagggt ctgacggtgc gcgatgtcca tgacgcgatc       120
     ggcgtcacgc ggggcctcgc ctacaccacg ctgatgaccg tcctcgaccg catggccaag       180
     aagcagctcg tcaccagaga gcgagacggc cgcgcctggc gctacctgcc cgcctcctcc       240
     cgcgacgagc tgacgtccga ggcgctccac cacaccctgg gtgagctcgc cggatcccaa       300
     cgtcgcagcg cgctgctccg cttcctcgac cagtccaccc ccgaggagct cgacgagctc       360
     cgtgcggcgc tggctgacct cgagcagcgt gagggcacgc accagaccgg ctag             414
//

If you have problems or comments...

PBIL Back to PBIL home page