(data stored in ACNUC7421 zone)

EMBL: CP002343.PE214

CP002343.PE214       Location/Qualifiers
FT   CDS_pept        complement(234207..235868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0219"
FT                   /product="ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydD"
FT                   /note="COGs: COG4988 ABC-type transport system involved in
FT                   cytochrome bd biosynthesis ATPase and permease components;
FT                   InterProIPR001140: IPR003439: IPR014216: IPR003593: IPR
FT                   017871: IPR017940; KEGG: kse:Ksed_01870 cysteine export
FT                   CydDC family ABC transporter permease subunit/ATP-binding
FT                   protein CydC; PFAM: ABC transporter related; ABC
FT                   transporter transmembrane region; SMART: AAA ATPase; SPTR:
FT                   Putative ABC transporter; TIGRFAM: ABC transporter, CydDC
FT                   cysteine exporter (CydDC-E) family, permease/ATP-binding
FT                   protein CydD; PFAM: ABC transporter transmembrane region;
FT                   ABC transporter; TIGRFAM: thiol reductant ABC exporter,
FT                   CydD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46776"
FT                   /db_xref="GOA:E6S636"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014216"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:E6S636"
FT                   /protein_id="ADU46776.1"
FT                   /translation="MRPFDPRLLHVVPAARRPVAALAAIGIATGVTTIATAFALTGVVV
FT                   AVVDDRPVAAPATWLGILFAIRAVLAWATEVVAAWAGVSVSTALRSALVRRWGAGPAAA
FT                   GSAPVDQATALSLATSGASAVEPYAARYLPTLVTAAVVPVVAVLALAVVDWPSALIVVL
FT                   TVPLLPLFAALIGRATEDSTQRRWAALASLSGHFLDVVRGLPTLVGYGRGRRQVEVVRE
FT                   VSERHRRATMETLRIAFLSSAALELLATISVALVAVTVGLRLSYGSMDLTPALAAILLA
FT                   PEAYWPIRRVGQEFHAAADGATALDDILGALADPPSPSPTGAPFARVDLRDVSYTYAAG
FT                   LAPVIRDLDLVVGSGLYAITGPSGVGKTTLLDLIAGLKAASSGSLTAPPSHYVTQRPFL
FT                   AAGSIRANLTLADDAERNARSDDALWQALRTVGLDGVVAGLPEGLSTRLGDDGFGLSAG
FT                   QRQRLALARAWLAPEPLLLLDEPTAHLDPEVADTVNALIVELAERRIVVVVTHRPELVA
FT                   VADEHLHLLPLPEPDGPRDDLAIPGLTPGVRPEVAR"
     atgaggccgt tcgacccgcg cctcctccac gtcgtcccgg cggcgcggag gccggtggcc        60
     gccctggcgg cgatcgggat cgcgaccgga gtcaccacga tcgccacggc gttcgccctc       120
     acgggcgtcg tcgtggcggt tgtcgatgac cgtccggttg ccgctcccgc cacctggctc       180
     ggcatcctct tcgccatccg ggcggtgctc gcctgggcga ccgaggtcgt cgccgcctgg       240
     gcgggcgtca gcgtgtcgac cgccctgcgc tccgccctgg tccgacgctg gggcgcgggt       300
     ccggctgcgg ccggcagcgc ccccgtcgac caggcgaccg cgctctccct cgccacctcg       360
     ggagcgagtg cggtcgagcc gtacgcggct cgctacctcc cgaccctcgt cacggcggcc       420
     gtcgtgccgg tcgtcgcggt cctggcgctc gccgtcgtcg actggccgag cgcgctcatc       480
     gtcgtcctca cggtcccgct cctgccgctg ttcgcggccc tcatcggccg cgcgacggag       540
     gactcgacgc agcgccgctg ggcagccctg gcgagcctgt ccgggcactt cctcgacgtc       600
     gtccggggtc tgccgacgct cgtcggctac gggcgggggc ggcgccaggt cgaggtcgtc       660
     cgtgaggtca gcgaacgcca ccgccgggcg acgatggaga cgctccgtat cgcgttcctc       720
     agctcggccg cgctcgagct cctggcgacg atcagtgtcg ccctcgtcgc cgtgacggtg       780
     ggcctgcgcc tgtcgtatgg ctcgatggac ctcaccccgg ccctcgccgc gatcctcctg       840
     gcccccgagg cgtactggcc gatccgccgg gtcgggcagg agttccacgc cgccgccgac       900
     ggcgcgaccg cgctcgacga catcctgggc gccctcgctg acccgccctc cccgtccccg       960
     accggcgccc cgttcgcccg ggtcgacctc agggacgtca gctacacgta tgccgctggg      1020
     ctggctcccg tgatccgtga cctcgacctc gtggtcgggt cgggcctcta cgccatcacc      1080
     ggcccctcgg gagtgggcaa gacgacgctc ctcgacctca tcgcgggtct caaggccgcc      1140
     tcgtccggtt cgctgacggc gccaccgtcg cactacgtca ctcaacgacc gttcctcgcc      1200
     gcgggctcca ttcgcgccaa cctcaccctc gcggacgacg ccgagcgcaa cgcccggtcc      1260
     gacgacgccc tctggcaggc gctccggacc gtgggcctcg acggtgtcgt cgccgggctt      1320
     cccgaggggc tgtcgacgag gctcggggac gacggcttcg gcctctccgc cggtcagcgg      1380
     caacgactcg cgctggcccg cgcctggctc gcccccgagc cgctgctgct gctcgacgag      1440
     cccaccgccc acctcgaccc cgaggtcgcc gacaccgtca acgcgctcat cgtcgagctc      1500
     gccgagcgcc gcatcgtcgt cgtcgtcacg caccgccccg agctcgtcgc cgtggcggac      1560
     gagcacctcc acctgctccc gctgcccgag ccggatggac cgcgcgacga cctggccatc      1620
     cccgggctca cccccggcgt ccggccggag gtggcccggt ga                         1662
//

If you have problems or comments...

PBIL Back to PBIL home page