(data stored in ACNUC7421 zone)

EMBL: CP002343.PE217

CP002343.PE217       Location/Qualifiers
FT   CDS_pept        238634..239011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0222"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COGs: COG1725 transcriptional regulator protein;
FT                   InterPro IPR000524; KEGG: nfa:nfa49100 putative
FT                   transcriptional regulator; PFAM: regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH; SPTR: Putative
FT                   transcriptional regulator; PFAM: Bacterial regulatory
FT                   proteins, gntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46779"
FT                   /db_xref="GOA:E6S639"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6S639"
FT                   /protein_id="ADU46779.1"
FT                   /translation="MTGPNDLSITIDPASAEPPFEQVRAQLAALIRSGRLLPGDRLPTV
FT                   RALAAHLGLAANTVARTYKELEAAGLVETRGRAGTVVASGEHTADVALAALAARYAVAA
FT                   REAGVDDATAVDLVRSALRSS"
     atgactggtc cgaacgacct gagcatcacc atcgacccgg catcggcgga gccgcccttc        60
     gagcaggtcc gcgcccagct cgccgccctc atccgctcgg gccggctcct gcccggggac       120
     cggctgccca cggtccgggc gctcgcggcc cacctcgggc tcgcggcgaa caccgtggct       180
     cgcacctaca aggagctcga ggcggccggg ctcgtcgaga ccaggggacg ggccggcacc       240
     gtcgtcgcct cgggggagca cacggccgac gtcgccctgg cggcgttggc cgcgaggtac       300
     gccgtagccg cccgggaggc cggcgtggat gacgcgaccg cggtcgacct ggtccgctcg       360
     gccctccgca gctcctga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page