(data stored in ACNUC7421 zone)

EMBL: CP002343.PE219

CP002343.PE219       Location/Qualifiers
FT   CDS_pept        complement(240158..241471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0224"
FT                   /product="phenylacetate-CoA ligase"
FT                   /EC_number="6.2.1.30"
FT                   /note="COGs: COG1541 Coenzyme F390 synthetase; InterPro
FT                   IPR000873: IPR011880; KEGG: kfl:Kfla_6851 phenylacetate-CoA
FT                   ligase; PFAM: AMP-dependent synthetase and ligase; PRIAM:
FT                   Phenylacetate--CoA ligase; SPTR: Phenylacetate-CoA ligase;
FT                   TIGRFAM: phenylacetate-CoA ligase; PFAM: AMP-binding
FT                   enzyme; TIGRFAM: phenylacetate-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46781"
FT                   /db_xref="GOA:E6S641"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E6S641"
FT                   /protein_id="ADU46781.1"
FT                   /translation="MTTESPAPALPDHEIPTLSVDELRHLQTERLRATISAAYANVPHY
FT                   TAAFDAKGLTPDDIRSLDDLRRLPFLAKADLRDYYPFGMFAVPRTEVVRIHASSGTTGR
FT                   PTVVGYTKQDIDTWADLMARSIRFAGGGPGDIIHVAYGYGLFTGGLGAHYGAERLGGTV
FT                   VPVSGGMTERQVQLIRDFGATVILVTPSYFLSLIDQMESEGIDPRSTSLRVGIFGAEPW
FT                   TEAMRREIEERTGMDAVDIYGLSEVMGPGVAQEAGTTKDGLHLWEDHFYPEIIDPVTEE
FT                   VLPDGEFGELVLTSLTRQAMPVIRYRTRDLTRLLPGTACPSMRRMEKVTGRSDDMMIIR
FT                   GVNVFPTQIEEFVLAEPRLSPYFQCVLRQPGRMVELTVLVEPVESLGDADADAIARHLQ
FT                   HEIKTNIGTSCRVEVRAPGSIERSIGKARRIVDERPKG"
     atgacgacgg agtcaccggc ccccgccctg cccgaccacg agatcccgac cctctcggtc        60
     gacgagctgc gccacctgca gacggagcgg ctgcgcgcga cgatctcagc ggcatacgcc       120
     aacgtcccgc actacacggc ggcgttcgac gcgaagggcc tgacgccgga cgacatccgg       180
     tcgctcgacg acctccgcag gctgccgttc ctcgccaagg ccgacctgcg ggactactac       240
     cccttcggga tgttcgccgt gccccggacc gaggtcgtgc gaatccacgc gagctccggc       300
     accaccggcc gccccacggt cgtcggctac acgaagcagg acatcgacac gtgggccgac       360
     ctgatggccc gctcgatccg cttcgccggc ggcggcccgg gcgacatcat ccacgtcgcc       420
     tacgggtacg gcctgttcac cggcgggctc ggcgcgcact acggggcgga gcggctcggc       480
     ggcaccgtcg tccccgtcag cggcggcatg acggagcggc aggtgcagct gatccgggac       540
     ttcggcgcaa cggtgatcct cgtgacgccg agctacttcc tctcgctcat cgaccagatg       600
     gagtccgagg ggatcgaccc gcggtcgacg agcctgcgcg tcgggatctt cggggcggag       660
     ccgtggaccg aggcgatgcg ccgcgagatc gaggagcgca cggggatgga cgcggtggac       720
     atctacggcc tgtccgaggt catggggccc ggcgtcgccc aggaggcggg cacgacgaag       780
     gacggcctgc acctgtggga ggaccacttc taccccgaga tcatcgaccc ggtcaccgag       840
     gaggtcctgc ccgacggcga gttcggcgag ctcgtcctca cctcgttgac gaggcaggcg       900
     atgccggtca tccgctaccg cacccgggac ctgacccgcc tcctgcccgg gacggcctgc       960
     ccgtcgatgc gccggatgga gaaggtcacc ggccgctccg acgacatgat gatcatccgg      1020
     ggggtcaacg tcttccccac ccagatcgag gagttcgtcc tcgccgagcc gcgcctgtcc      1080
     ccctacttcc agtgcgtgct gcgccagccc ggccggatgg tggagctgac cgtcctcgtc      1140
     gagccggtgg agtcgctcgg cgacgccgac gccgacgcga tcgcccgtca cctgcagcac      1200
     gagatcaaga cgaacatcgg cacctcgtgc cgggtcgagg tgcgagcgcc ggggtcgatc      1260
     gagcggtcca tcggcaaggc gcggcgcatc gtcgacgaac gccccaaggg gtga            1314
//

If you have problems or comments...

PBIL Back to PBIL home page