(data stored in ACNUC7421 zone)

EMBL: CP002343.PE22

CP002343.PE22        Location/Qualifiers
FT   CDS_pept        23708..24142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0022"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tbr:Tb11.02.3740 receptor-type adenylate
FT                   cyclase GRESAG 4; SPTR: Receptor-type adenylate cyclase
FT                   GRESAG 4, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46584"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEI3"
FT                   /protein_id="ADU46584.1"
FT                   /translation="MTIDCTNSRPALNDSKAPIVLKFHVPMRRDTLNILNIIYKNVEFV
FT                   RMGVSADVNRALVSAKEGQPIDGMRGAVVTNLVGDKDYESLRFLFKVATDTDLGKLLVA
FT                   LGVDPATDFDQYTRGVAADFAVFERLMANPPKKQGFFGKW"
     atgaccatcg actgcaccaa cagtcgtccc gccctgaacg atagtaaggc tcccatcgtg        60
     cttaagtttc atgttcccat gcgccgagac accctcaaca tactgaatat catctacaag       120
     aacgttgagt tcgtgcggat gggggtgagt gctgacgtca accgtgcgtt ggtctccgcg       180
     aaggagggcc agccaatcga tggcatgcgt ggcgctgtcg tcaccaactt ggtcggcgac       240
     aaggactacg aaagtctgcg attcctgttc aaagtggcaa cggataccga tcttgggaaa       300
     ctgctagtcg ctctcggcgt cgacccagcg acagactttg atcagtacac ccggggcgtg       360
     gcggccgact tcgcagtctt cgaacgcctg atggcgaacc caccgaagaa gcaggggttc       420
     ttcggaaagt ggtga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page