(data stored in SCRATCH zone)

EMBL: CP002343.PE220

CP002343.PE220       Location/Qualifiers
FT   CDS_pept        complement(241538..242416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0225"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="COGs: COG1126 ABC-type polar amino acid transport
FT                   system ATPase component; InterPro IPR003439: IPR003593:
FT                   IPR017871; KEGG: sma:SAV_2984 arginine/ornithine transport
FT                   ATP-binding protein; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase; SPTR: Putative arginine/ornithine ABC transport
FT                   ATP-binding protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46782"
FT                   /db_xref="GOA:E6S642"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:E6S642"
FT                   /protein_id="ADU46782.1"
FT                   /translation="MTTTTNQQGRPDQRTRADGSQPLVRAVNVTKSFHGNEVLKGIDLT
FT                   VHRGEVVVLLGPSGSGKTTFLRCINQLETIDGGRIWVDGDLMGYREDEKGHLHHLTDKQ
FT                   VSAQRRDIGMVFQRFNLFPHKTALENVMEAPMQVKGVSKAKARARGLELLERVGLADKP
FT                   KAYPGALSGGQQQRVAIARALAMDPKLMLFDEPTSALDPELVGEVLRVMRDLAEAGMTM
FT                   IVVTHEMGFAREVADHVVFMDAGVVCEEGTARDVISNPQQERTRSFLRRMRSEEQQERR
FT                   DEQEQEQVEPA"
     atgacgacca cgacgaacca gcagggccgg ccggaccagc ggacccgcgc cgacgggagc        60
     caaccgctcg tgcgcgccgt caacgtgacg aagtccttcc acggcaacga ggtgctcaag       120
     ggcatcgacc tgaccgttca ccggggcgag gtcgtcgtcc tgctcggccc ctccggctcc       180
     ggcaagacga ccttcctgcg ctgcatcaac cagctcgaga cgatcgacgg cggccggatc       240
     tgggtcgacg gcgacctcat gggctaccgc gaggacgaga agggacacct gcaccacctg       300
     accgacaagc aggtgtcggc gcaacgtcgc gacatcggca tggtcttcca gcggttcaac       360
     ctcttcccgc acaagacggc cctcgagaac gtcatggagg cgccgatgca ggtcaagggc       420
     gtcagcaagg ccaaggcgag ggcccgcggc ctcgagctgc tcgagcgcgt cggtctcgcg       480
     gacaagccga aggcgtaccc cggggccctc tccggtggcc agcagcagcg cgtcgccatc       540
     gcccgggccc tcgccatgga ccccaagctg atgctcttcg acgagccgac gtcggccctc       600
     gaccccgagc tcgtcggcga ggtgctccgc gtcatgcgcg acctcgccga ggccggcatg       660
     acgatgatcg tcgtgacgca cgagatgggc ttcgcgcgtg aggtcgccga ccacgtcgtc       720
     ttcatggacg ccggcgtcgt ctgcgaggaa ggcaccgccc gggacgtcat cagcaacccg       780
     cagcaggagc ggacccgctc cttcctgcgc cggatgcgct cggaggagca gcaggaacgg       840
     cgtgacgagc aggagcagga gcaggtcgag cccgcctga                              879
//

If you have problems or comments...

PBIL Back to PBIL home page