(data stored in ACNUC7421 zone)

EMBL: CP002343.PE223

CP002343.PE223       Location/Qualifiers
FT   CDS_pept        244676..246262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0228"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="COGs: COG0513 Superfamily II DNA and RNA helicase;
FT                   InterProIPR011545: IPR001650: IPR014001: IPR014021: IPR
FT                   014014; KEGG: nca:Noca_4567 DEAD/DEAH box helicase
FT                   domain-containing protein; PFAM: DEAD/DEAH box helicase
FT                   domain protein; helicase domain protein; SMART: DEAD-like
FT                   helicase; helicase domain protein; SPTR: ATP-dependent RNA
FT                   helicase; PFAM: Helicase conserved C-terminal domain;
FT                   DEAD/DEAH box helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46785"
FT                   /db_xref="GOA:E6S645"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6S645"
FT                   /protein_id="ADU46785.1"
FT                   /translation="MSIDTTDLTFGALGVPSALTAALADLGITTPTPIQAATLPDSLAG
FT                   RDVLGRGRTGSGKTYAFLLPIVARLAAAPTRRSPGRPRALILAPTRELATQIDTALAPL
FT                   AATAGLNSLTIFGGVGQNPQVQGLRRGVDVVVACPGRLEDLMGQGHVSLDSVEITVLDE
FT                   ADHMADLGFLPGVRRIMDKTPATGQRMLFSATLDGAINVIVKRFLTSPRTHEADSAQSP
FT                   VSTMAHHVLHVTSDAHLAVILDLAAAPGRKVVFTRTKHRAKKLAKQLNSSGVPAVELHG
FT                   NLSQGARTRNMDDFHSGRAQTLVATDIAARGIHVDDVALVIHADPPVEHKAYLHRSGRT
FT                   ARAGADGTVVTMMLDDQVRDVRDLTRKAGIKPTTTRVAVGHPLLVELAPGERSYAAGLV
FT                   REAVPTVGGGARRQGGSGSSRGTGARDGAGQGRAGGGRAGGGRAGGGRGAGRSGGSAAA
FT                   GGSGSSAASGSGRRGGSGSSGSSAGARAGAGGNGGRGRQGGSATVYSTSSGGGAAAFSA
FT                   GTRAGSRRRAG"
     gtgtccatcg acacgactga cctgaccttc ggcgcgctcg gcgtgccgtc cgccctcacc        60
     gcggcgctgg ccgacctcgg catcacgacg ccgaccccga tccaggccgc gaccctcccc       120
     gactcgctgg ccggtcgcga cgtcctcggc cgtggccgca ccggctcggg caagacgtac       180
     gccttcctcc tgccgatcgt ggcccgtctc gccgcggcgc cgacccggcg cagcccgggc       240
     cgacctcgtg cgctcattct cgccccgacc cgtgagctgg ccacgcagat cgacacggcc       300
     ctggcgccgc tggccgcgac ggccggcctc aacagcctga cgatcttcgg tggcgtgggc       360
     cagaacccgc aggtgcaggg cctgcgccgc ggcgtcgacg tcgtcgtcgc ctgcccgggt       420
     cgtctcgagg acctgatggg ccagggccac gtgtccctcg actcggtcga gatcaccgtg       480
     ctcgacgagg ccgaccacat ggccgacctc ggcttcctcc ccggtgtccg gcggatcatg       540
     gacaagacgc cggcgacggg ccagcggatg ctgttctccg cgacgctcga cggcgcgatc       600
     aacgtcatcg tcaagcgctt cctcaccagc ccccgcaccc acgaggcgga ctcggcccag       660
     tcgccggtct ccacgatggc gcaccacgtc ctgcacgtca cctccgacgc gcacctggcg       720
     gtcatcctcg acctcgccgc ggccccgggc cgcaaggtcg tcttcacgcg gaccaagcac       780
     cgggccaaga agcttgccaa gcagctcaac tcgtcgggag ttccggccgt cgagctgcac       840
     ggcaacctca gccagggcgc gcggacccgc aacatggacg acttccacag cggtcgggcc       900
     cagacgctcg tcgcgacgga catcgcagcc cgcggcatcc acgtcgacga cgtggcgctc       960
     gtcatccacg ccgacccgcc ggtcgagcac aaggcctacc tccaccgctc gggtcgcacc      1020
     gcgcgtgcgg gggctgacgg cacggtcgtg acgatgatgc tcgacgacca ggtgcgcgac      1080
     gtccgtgacc tgacgcgcaa ggccggcatc aagccgacga cgacgcgcgt tgcggtggga      1140
     caccccctcc tcgtggagct cgctcccggt gagcggtcgt atgccgctgg gctcgtccgg      1200
     gaggccgtcc ccaccgtggg tggtggcgct cgcagacaag gtggatccgg atcgtcccgc      1260
     gggaccggtg ctcgggacgg ggccgggcag ggtcgcgccg gtggcggtcg ggccggtggt      1320
     ggtcgcgccg gtggtggccg cggggcgggt cggtccggtg ggtccgccgc tgcgggcggc      1380
     tccggctcct cggccgcgtc cggcagcggg cgccgtggtg gcagtggcag cagtggcagc      1440
     agtgccggtg cccgcgccgg ggccggcggc aacggtggac ggggccggca gggcggcagc      1500
     gccacggtgt actcgacgag ctccggcggt ggagcagcgg cgttctcggc cggcacccgc      1560
     gccggaagcc gccgccgggc cggctga                                          1587
//

If you have problems or comments...

PBIL Back to PBIL home page