(data stored in ACNUC7421 zone)

EMBL: CP002343.PE224

CP002343.PE224       Location/Qualifiers
FT   CDS_pept        complement(246324..247094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0229"
FT                   /product="RDD domain containing protein"
FT                   /note="COGs: COG1714 membrane protein/domain; InterPro
FT                   IPR010432; KEGG: gbr:Gbro_4825 RDD domain containing
FT                   protein; PFAM: RDD domain containing protein; SPTR:
FT                   Possible conserved membrane protein; PFAM: RDD family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46786"
FT                   /db_xref="GOA:E6S646"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:E6S646"
FT                   /protein_id="ADU46786.1"
FT                   /translation="MTGEGVALEVPVASIGTRVLSGLIDVVLHVGLLVGVFFAAGALTG
FT                   QSSEAVSRTAVIVSFVAVLVGVPTVSETLTRGKTLGKLITGLRVVRDDGGPISFRHALA
FT                   RALVGWVEVYLLTGVAAVIAALVTARTKRLGDLAAGTYVIAERSRLELPLPPVAPLALE
FT                   GWARRADIAPVAADLAVAVRQFLPRARLLVPEARQALGRQLLARVLPLVAPPPPPGNDP
FT                   EAILTAVMAERYRRDLERLHREQALRERALPDSR"
     gtgaccggtg agggcgtcgc gctcgaggtg cccgtcgcga gcatcggcac ccgcgtcctg        60
     tccggcctca tcgacgtcgt gctgcacgtc gggctgctcg tcggcgtctt cttcgcggcc       120
     ggggccctga ccggccagtc ctccgaggcg gtctcacgca cggccgtcat cgtgtccttc       180
     gtcgcggtgc tcgtcggtgt gcccacggtg tcggagacgc tgacccgcgg gaagacgttg       240
     ggcaagctca tcaccgggct gcgggtcgtg cgggacgacg gtggaccgat ctcgttccgg       300
     cacgcgctgg cccgggctct cgtggggtgg gtcgaggtgt acctgctgac cggggtggcg       360
     gccgtcatcg ccgccctcgt cacggcccgg acgaaacggc tcggggacct cgctgccggc       420
     acctacgtca tcgccgagcg aagccgtctg gagctgccgt tgccacccgt cgcgccactc       480
     gccctggagg gctgggcccg gcgagccgac atcgcgccgg tggccgctga cctggccgtg       540
     gccgtccgac agttcctgcc ccgggcccgg ctcctcgtgc cggaggcgag gcaggccctg       600
     ggccgtcagc tgctggcccg ggtgctgccg ctcgtcgctc ctccgccccc gcccgggaac       660
     gaccccgagg cgatcctcac ggcggtgatg gccgagcgct accgccggga cctcgagcgg       720
     ttgcaccgcg agcaggccct gcgagaaaga gccctccccg attcgaggtg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page