(data stored in ACNUC7421 zone)

EMBL: CP002343.PE226

CP002343.PE226       Location/Qualifiers
FT   CDS_pept        complement(248352..249647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0231"
FT                   /product="protein of unknown function DUF58"
FT                   /note="COGs: COG1721 conserved hypothetical protein (some
FT                   members contain a von Willebrand factor type A (vWA)
FT                   domain); InterPro IPR002881; KEGG: nca:Noca_3911
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF58; SPTR: Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function DUF58"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46788"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:E6S648"
FT                   /protein_id="ADU46788.1"
FT                   /translation="MVLTGRAALVVLLGAVAVAWRPGVGTVLLWTLGVLVLVLADLALA
FT                   PSPRGLVIERSVAPLVRLGEAVTSELLVTNPGRRAVRGQVRDAWQPSAGAEHDRHDLRL
FT                   RSGDRVRLTTRLRPTRRGDRHADLVTLRLHGPLGLAARQASITVAGTIRVLHPFHSRRH
FT                   LPSKLSRLRQIDGRSAVRRRGQGTEFDSLRDYVEGDDVRSIDWRATARRGSVVVRTWRP
FT                   EQHRRIVVVVDTSRTSAGRVGDVPRLDAAMDATLLLTALAGHAHDRVDVIAGDQRVRVR
FT                   VIGSTDRTSPLAEVVSALAPIQPAIVEADWSALASAVVSRHHQRSLVVLLTPLEPAAIE
FT                   EGLLPVIPTLVARHRVVLASVADPAVGTLLAERTTVADVYGAAAAERTMARRERVAAAL
FT                   ARLGVDVIDAEADELPARLADHYLWLKSEGLL"
     atggtcctga cgggccgggc cgccctcgtg gtcctgctcg gcgcggtcgc cgttgcctgg        60
     cgtccgggcg tcggaacggt gctgctgtgg acgctcggag tcctcgttct cgtcctggcc       120
     gatctcgccc tggcgccctc cccgcgtggt ctcgtgatcg agcggtcggt ggcgccgctg       180
     gtccggctcg gcgaggccgt cacgagcgag ctgctggtga ccaacccggg ccggcgagcg       240
     gtccgaggcc aggtccggga tgcgtggcag ccgtccgccg gggcggagca cgaccggcac       300
     gacctgcggc tccgctccgg ggaccgcgtg cggctgacca cccggctgcg cccgacgcgg       360
     cggggtgacc ggcacgccga cctggtgacg ctgcgcctgc acggacccct gggcctcgcc       420
     gcccgccagg cctccatcac cgtcgccggg acgatccggg tgctccatcc cttccactcg       480
     cggcgccacc tgccgagcaa gctgtcccgc ctgcgccaga tcgacgggcg ctccgccgtc       540
     cgccggcgcg gccagggcac cgagttcgac tccctgcgcg actacgtcga gggcgacgac       600
     gtgcggtcga tcgactggcg ggccaccgcc cggcgagggt cggtcgtcgt ccgcacatgg       660
     cggccggagc agcaccgtcg catcgtcgtc gtcgtcgaca cgtcgcggac cagcgccggc       720
     cgggtcggcg acgtcccccg cctcgatgcg gcgatggacg ccaccctgct cctcacggcg       780
     ctcgcggggc acgcgcacga ccgcgtcgac gtcatcgcgg gggatcagcg ggtgcgcgtg       840
     cgggtgatcg ggtcgaccga ccggacgagc ccgctcgccg aggtggtctc cgcgctcgcg       900
     ccgatccagc cggccatcgt cgaggccgac tggtccgccc tggcgtccgc cgtggtcagc       960
     cgccaccacc agcgatccct cgtcgtgctg ctcaccccgc tcgagccggc ggccatcgag      1020
     gagggtctgc tccccgtcat cccgacgctc gtcgcacggc accgggtcgt cctcgccagc      1080
     gtcgccgatc ctgcggtcgg aaccctcctg gccgagcgca ccaccgtggc cgacgtctac      1140
     ggcgccgcgg ccgcggagcg caccatggcc cgacgggagc gcgtggcggc cgccctcgcg      1200
     cggctgggcg tcgacgtcat cgacgccgag gccgatgagc tgccggccag gctcgccgac      1260
     cactacctct ggctcaagag cgaaggcctc ctctga                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page