(data stored in ACNUC7421 zone)

EMBL: CP002343.PE227

CP002343.PE227       Location/Qualifiers
FT   CDS_pept        complement(249670..250677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0232"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="COGs: COG0714 MoxR-like ATPase; InterPro IPR011703:
FT                   IPR016366: IPR003593; KEGG: gbr:Gbro_4821 ATPase associated
FT                   with various cellular activities AAA_3; PFAM: ATPase
FT                   associated with various cellular activities AAA_3; SMART:
FT                   AAA ATPase; SPTR: Putative regulatory protein; PFAM: ATPase
FT                   family associated with various cellular activities (AAA)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46789"
FT                   /db_xref="GOA:E6S649"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:E6S649"
FT                   /protein_id="ADU46789.1"
FT                   /translation="MTDHTTDTPTHDPGRPDDAGRAALDALLAVRAEVGKAVVGQEAAV
FT                   TGAIVALLTRGHILLEGVPGVAKTLLVRALAAALDVTTKRVQFTPDLMPGDVTGSLVLD
FT                   PRTSDFTFREGPVFTNLLLADEINRTPPKTQSALLEAMEERQVTVEGTARPLPRPFLVA
FT                   ATQNPVEYEGTYPLPEAQLDRFLLKVSLPLPAREDEVEVLRRHATGFDPRDLAAAGLTA
FT                   VAGPADLAAGSAAVQRVVVSPEITGYIVDIARATRTSPSLALGVSPRGATALLATSRAW
FT                   AWLHRRAFVTPDDVKAMAHATLAHRLALRPEAELEGVSVAAVLDSALGSVAVPR"
     atgaccgacc acaccactga caccccgacc catgatcccg ggcgccccga cgacgccgga        60
     cgggccgccc tcgacgcact gctcgccgtc cgggcggagg tcggcaaggc cgtcgtcggg       120
     caggaggcgg ccgtgaccgg tgccatcgtc gcgctcctga cccggggcca catcctgctc       180
     gaaggggttc cgggggtggc caagaccctc ctcgtccggg ccctcgcagc cgcgctcgac       240
     gtcacgacca agcgagtgca gttcaccccc gacctcatgc ccggcgacgt gaccggctcg       300
     ctcgtgctcg acccgaggac gagcgacttc accttccggg aaggaccggt cttcaccaac       360
     ctcctgctgg ccgacgagat caaccggacg ccgccgaaga cgcagtccgc cctcctcgag       420
     gcgatggagg aacggcaggt gaccgtggag gggaccgccc ggccgctgcc ccgtccgttc       480
     ctcgtcgcag ccacccagaa ccccgtcgag tacgagggca cctacccgtt gcccgaggcc       540
     cagctcgacc ggttcctcct caaggtgagc ctgcccctgc cggcgcgaga ggacgaggtc       600
     gaggtcctgc gccgccatgc gaccggcttc gacccccggg acctcgccgc tgccggcctg       660
     acagccgtgg ccgggccggc cgacctcgcc gcggggtccg ccgccgtgca gcgagtcgtc       720
     gtctcccccg agatcacggg ttacatcgtc gacatcgccc gggcgacccg cacctccccc       780
     tccttggccc tcggagtcag cccgcgcggg gccaccgccc tgctcgcgac gagccgggcc       840
     tgggcgtggc tgcaccggcg cgccttcgtc acccccgacg acgtcaaggc gatggcccac       900
     gcgacgctgg cgcaccgcct cgccctccgt cccgaggccg agctggaggg agtgagcgtc       960
     gcagccgtgc tcgacagcgc gctgggctcc gtggcggtgc ctcggtga                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page