(data stored in ACNUC7421 zone)

EMBL: CP002343.PE228

CP002343.PE228       Location/Qualifiers
FT   CDS_pept        complement(250674..251921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0233"
FT                   /product="secreted protein"
FT                   /note="KEGG: nca:Noca_3909 secreted protein; SPTR: Secreted
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46790"
FT                   /db_xref="GOA:E6S6Q4"
FT                   /db_xref="InterPro:IPR025646"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6Q4"
FT                   /protein_id="ADU46790.1"
FT                   /translation="MSTRLPEATALPALPALPGGSPASAGPPARRRWGLAALLAVAGIV
FT                   AVGLLAVLSGGAGRSGTLGDPDSASRNGSRALAEVLRQQGVQVEVVRTIRAFEAARVDP
FT                   STTVVVGSFDYLGEAAAERTSRHSSSARRLVLLEPGDLALGDLGVPLVTTGGGRAELTG
FT                   GCNSDIVEADDRLDATTTVYASADDDGPALPRGATGCFPEKQSGVALVVLPASGAQPET
FT                   VVLGSADALTNARVGDASHAAVGLRSLGNSERLVWYVPGLSDLDVADASGEHRSSDRGV
FT                   PDWFDPGVLLLVIAFIAFALARGRRLGRIVTEPLPVVVRAVETTEARGRLYRRAGDRGR
FT                   AASSLRSGTRHRLAARLGLPTPTVGSDLVEAVARAAGRGTAEVRALLDGPAPTNDRDLV
FT                   LLAEQLAQLEENVRRA"
     gtgagcaccc ggctgccgga ggccaccgcc ctgcccgccc tgcccgccct gccgggtggg        60
     tccccggcca gcgccgggcc cccggcgcga cgtcgctggg gcctcgccgc cctcctcgcc       120
     gttgccggga tcgtggcggt gggtctgctg gcggtcctct ccggtggagc tggtcgctcg       180
     gggacgctgg gtgacccgga cagtgcctcg cggaacgggt cccgagcgct cgccgaggtc       240
     ctgcgtcagc agggcgtgca ggtcgaggtc gtgcggacga tccgagcctt cgaggccgcg       300
     cgggtggacc cgagcaccac cgtggtcgtg gggtccttcg actacctggg cgaggcggct       360
     gccgagcgca cctcccggca ctcgtcatcc gctcgccggc tcgtcctgct cgagcccggg       420
     gacctcgccc tgggcgacct gggtgtccct ctcgtgacga ccggaggggg gcgggcagag       480
     ctgaccggcg ggtgcaactc cgacatcgtc gaggccgacg accggctcga cgccacgacc       540
     accgtctacg catctgccga cgacgacggg ccggccctcc cgcgcggcgc gacgggctgt       600
     ttccccgaga agcagtcggg cgtcgcgctc gtcgtgctgc ctgcgtcggg cgcccagccc       660
     gagaccgtgg tcctcggctc ggctgacgcc ctgaccaacg cgcgggtcgg cgacgcctcc       720
     cacgcagcgg tcggacttcg ctccctcggc aacagcgagc ggctcgtctg gtacgtgccc       780
     ggcctctccg acctggatgt ggctgacgcc agcggcgaac atcgctcgtc cgaccgaggg       840
     gtgccggact ggttcgaccc cggcgtcctc ctgctcgtca tcgcgttcat cgccttcgcg       900
     ctcgcgcgtg ggcggcggct gggccggatc gtcaccgagc cgctgccggt cgtggtgcgc       960
     gccgtcgaga cgaccgaggc ccgggggcgg ctgtaccgcc gcgccggtga ccggggccga      1020
     gcggccagca gcctgagatc ggggacccgg caccgtctgg cggcacggct cggtctgccc      1080
     accccgaccg tggggtcgga cctggtcgag gcggtggccc gggccgcagg gcgtggcacc      1140
     gcggaggtcc gtgcgctgct cgacggcccc gccccaacga acgacagaga cctggtgctg      1200
     ctcgccgagc agctggccca actcgaggag aacgtgcgac gcgcatga                   1248
//

If you have problems or comments...

PBIL Back to PBIL home page