(data stored in SCRATCH zone)

EMBL: CP002343.PE229

CP002343.PE229       Location/Qualifiers
FT   CDS_pept        complement(251918..252562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0234"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amd:AMED_1140 hypothetical protein; SPTR:
FT                   Putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46791"
FT                   /db_xref="GOA:E6S6Q5"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6Q5"
FT                   /protein_id="ADU46791.1"
FT                   /translation="MHVWAVSVPVDPSAEEAREWVLRELSRPEYADERGLLQRLLDWVG
FT                   DLVDELLRHDPGALPGWVLPVVLALLAALLGVVLVTRLGREAGTPRGGAGGVLDEPHLD
FT                   AEAYRARARAAYAVGEVDDAATDWFRAIAASASERAVIDESPGRTAHEVSVALAALLPE
FT                   EAPALSRAADQFDAIRYGDAHVDEAVARSIADLDTRLAASRPFLRRTRVTP"
     gtgcacgtct gggccgtgtc cgtgccggtc gacccctcgg ccgaggaggc tcgagagtgg        60
     gtgctgcgag agctgtcccg ccccgagtac gccgacgagc gcggcctgct ccagcggctg       120
     ctcgactggg tcggtgacct cgtcgacgag ctgctgcggc acgacccggg agccctgccg       180
     gggtgggtgc tgcccgtcgt gctggcgctc ctcgcggctc tcctcggcgt ggtcctcgtc       240
     acgaggctcg gccgggaagc gggaacaccc cggggcggcg cgggtggcgt cctcgacgag       300
     ccgcacctcg acgccgaggc gtaccgggcg cgggcgcggg ctgcctacgc cgtcggtgag       360
     gtcgacgacg cggcgacgga ctggttccgg gccatcgctg cctccgcatc ggagcgagcc       420
     gtcatcgacg agagccccgg ccggaccgcc cacgaggtga gcgtggccct cgcagcgctc       480
     ctgcccgagg aggcgccggc tctgagtcgc gccgccgacc agttcgatgc catccgctac       540
     ggagacgccc acgtcgacga ggcggtcgcc cggtccatcg ccgatctcga cacccggctc       600
     gctgcctccc ggccgtttct ccggcgcacg agggtgaccc cgtga                       645
//

If you have problems or comments...

PBIL Back to PBIL home page