(data stored in ACNUC7421 zone)

EMBL: CP002343.PE231

CP002343.PE231       Location/Qualifiers
FT   CDS_pept        complement(253738..254169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0236"
FT                   /product="phenylacetic acid degradation protein PaaD"
FT                   /note="COGs: COG2050 Uncharacterized protein possibly
FT                   involved in aromatic compounds catabolism; InterPro
FT                   IPR006683: IPR003736: IPR011973; KEGG: kfl:Kfla_6849
FT                   phenylacetic acid degradation protein PaaD; PFAM:
FT                   thioesterase superfamily protein; SPTR: Probable
FT                   phenylacetic acid degradation protein; TIGRFAM:
FT                   phenylacetic acid degradation protein PaaD; PFAM:
FT                   Thioesterase superfamily; TIGRFAM: uncharacterized domain
FT                   1; phenylacetic acid degradation protein PaaD"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46793"
FT                   /db_xref="GOA:E6S6Q7"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR011973"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6Q7"
FT                   /protein_id="ADU46793.1"
FT                   /translation="MSEPVGGGEDAGVAFARQMWADDEASRRLGMEAVVIEQDHAVVRM
FT                   PVRADMVNGHDICHGGFVFTLADSTFALACNSRGVVTVASGADITFTAPSRLGDVLVAE
FT                   GMVRSAFGRSGITDVTVKRESDGQIIAEFRGRSRSLKRQ"
     atgagcgaac ccgtgggcgg tggcgaggac gccggcgtgg cgttcgcgcg gcagatgtgg        60
     gctgacgacg aggcctcccg ccggctcggc atggaggcgg tcgtcatcga gcaggaccac       120
     gccgtcgtcc ggatgccggt ccgcgcggac atggtcaacg ggcacgacat ctgccacggc       180
     ggcttcgtct tcacgctcgc cgactcgacc ttcgcgctgg cctgcaactc ccgcggcgtg       240
     gtgacggtcg cgtccggggc cgacatcacc ttcaccgcgc cgagccgcct cggggacgtg       300
     ctcgtcgcgg aggggatggt gcgatccgcc ttcggccgca gcgggatcac cgacgtgacc       360
     gtcaagcgcg agtcggacgg gcagatcatc gccgagttcc gcggccggag caggtccctc       420
     aagcgtcagt ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page