(data stored in ACNUC7421 zone)

EMBL: CP002343.PE232

CP002343.PE232       Location/Qualifiers
FT   CDS_pept        complement(254166..255341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0237"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding
FT                   protein"
FT                   /EC_number="1.1.1.157"
FT                   /note="COGs: COG1250 3-hydroxyacyl-CoA dehydrogenase;
FT                   InterPro IPR006176: IPR006108: IPR006180; KEGG:
FT                   kse:Ksed_01910 3-hydroxyacyl-CoA dehydrogenase; PFAM:
FT                   3-hydroxyacyl-CoA dehydrogenase NAD-binding;
FT                   3-hydroxyacyl-CoA dehydrogenase domain-containing protein;
FT                   SPTR: 3-hydroxyacyl-CoA dehydrogenase; PFAM:
FT                   3-hydroxyacyl-CoA dehydrogenase, C-terminal domain;
FT                   3-hydroxyacyl-CoA dehydrogenase, NAD binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46794"
FT                   /db_xref="GOA:E6S6Q8"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6Q8"
FT                   /protein_id="ADU46794.1"
FT                   /translation="MNLTDVAVIGAGAMGAGIAQVAATAGHRVSLVDAVPGAAEAATDR
FT                   LGGGLDRLVAKGRLTADDAAAIRGRLTPAGSVAELPDCGLVIEAVPEDLALKRKIFGEL
FT                   GGSQPASTILATNTSSIDVSAIAEAVIHPERVVGLHFFNPPQVMALVEVIHGARSSATV
FT                   LDEAVELMRAWGKTPVRCSSTPGFIVNRVARPFYGEAQRMVEAGVADAATIDWILREKG
FT                   GFPMGPLELTDFIGQDVNLAVGTSVWEQTGRDERYAPTEFQRGLVEAGRLGRKTGQGVY
FT                   TYAADGVLVGGDPDLGLAERLVGGPVETDPLARTVAMLVNEAADLVGRGEATAADVDIA
FT                   MVLGTRYPRGPIEWGRSLGFAVVSRQIEELDRVFPGGRYRPSPALLDGTVQ"
     atgaacctca ctgacgtcgc tgtcatcgga gccggcgcga tgggtgccgg gatcgcgcag        60
     gtggccgcca cggccggtca ccgggtgagc ctcgtggacg ccgtcccggg tgctgcggag       120
     gccgcgaccg accggttggg gggcggcctc gaccgcctcg tcgcgaaggg ccggctcacc       180
     gccgacgacg ccgcggcgat ccgcgggcgc ctgacaccgg ccggctcggt cgccgagctg       240
     cccgactgcg gcctggtcat cgaggcggtc cccgaggacc tggccctcaa gcggaagatc       300
     ttcggcgagc tcggcggctc gcagcccgcc tcgacgatcc tcgcgacgaa cacctcgagc       360
     atcgacgtgt cggcgatcgc cgaggcggtc atccatcccg agcgggtcgt cggcctgcac       420
     ttcttcaacc cgccgcaggt gatggcgctc gtcgaggtga tccacggcgc acggtcctcg       480
     gccacggtgc tcgacgaggc ggtggagctg atgcgcgcct ggggcaagac ccccgtgcgc       540
     tgctcgtcga cgcccggctt catcgtcaac cgcgtcgccc ggccgttcta cggcgaggcg       600
     cagcggatgg tcgaggcggg cgtggcagac gccgcgacga tcgactggat cctgcgggag       660
     aagggcggct tcccgatggg gccgctcgag ctgaccgact tcatcggcca ggacgtcaac       720
     ctcgccgtcg gcacgtccgt ctgggagcag accgggcggg acgagcgcta cgcgccgacg       780
     gagttccagc gtggcctcgt cgaggcgggc cggctcggtc gcaagaccgg gcagggcgtc       840
     tacacgtatg ccgctgacgg cgttctcgtc ggcggtgacc ccgacctcgg gctggctgag       900
     cgtctcgtcg gcggcccggt cgagaccgac ccgctcgcgc ggacggtggc gatgctcgtc       960
     aacgaggccg ctgacctcgt cgggcggggg gaggccaccg cagcggacgt cgacatcgcg      1020
     atggtgctcg ggacccgcta cccgcgcggg ccgatcgagt gggggcggtc gctcggcttc      1080
     gccgtggtct cccgccagat cgaggagctc gaccgggtct tccccggggg gcgctaccga      1140
     ccgagccccg ccctcctcga cggaacggtg caatga                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page