(data stored in ACNUC7421 zone)

EMBL: CP002343.PE233

CP002343.PE233       Location/Qualifiers
FT   CDS_pept        255397..257121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0238"
FT                   /product="phenylacetic acid degradation protein paaN"
FT                   /note="COGs: COG1012 NAD-dependent aldehyde dehydrogenase;
FT                   InterPro IPR015590: IPR011975; KEGG: kse:Ksed_01930
FT                   phenylacetic acid degradation protein PaaN; PFAM: Aldehyde
FT                   Dehydrogenase; SPTR: Phenylacetic acid degradation protein
FT                   paaN; TIGRFAM: phenylacetic acid degradation protein paaN;
FT                   PFAM: Aldehyde dehydrogenase family; TIGRFAM: phenylacetic
FT                   acid degradation protein paaN"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46795"
FT                   /db_xref="GOA:E6S6Q9"
FT                   /db_xref="InterPro:IPR011975"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6Q9"
FT                   /protein_id="ADU46795.1"
FT                   /translation="MTAQATKPTHPLLDQHAGVLDEIRQALAERSWFSRYPESPSPRVY
FT                   GETAAADGLAAYEAHLNRPYAAELASGVTGTFVGSEVSPYGPTLGVSYPALDLDAALAA
FT                   ARAAVPAWRDAGPQVRAAVCVEIVDAINRRSFEVANAVMHTSGQPFVMSFQAGGPHAQE
FT                   RALEAVAAGLVEQERVPASVVWEKPGKDREGKPAPIRMQKDYRIVPRGVSLVIGCNTFP
FT                   TWNAYPGIFASLVTGNPVVIKPHPRAVLPLAITVEAARGVLAAAGFDPALVQLAAEVDG
FT                   QGLARTLAERDEVAIIDYTGGPAFGGWLEERGAALGKLVYTEKAGLNTVVVDSTDDLKG
FT                   LLGNLAFSLTLYSGQMCTAPQNIYVPTGGVDTDEGHLSFDEFGERLGSAVSRLTGDDAK
FT                   AVELLGATVNDQVRANAESLEAMAAEAEGRVLLQSRRIAHPVYAEAVVRAPGLVAVDVQ
FT                   REDVYTQECFGPVGFLIQTASTEQSLAQLADTVKEHGGMTASVYSTSEEVLEGAREAAA
FT                   TGGVALSENLTGQIFVNQTAAFSDFHGTGANPAANAAYTDSAFVANRFRVITARRHI"
     gtgactgcac aggcaacgaa gcccacccac ccgctgctcg accagcacgc cggcgtcctc        60
     gacgagatcc gtcaggcgct cgccgaacga tcctggttct cccgctaccc cgagtccccg       120
     tccccgcgcg tctatggcga gacggcggcc gccgacgggc tcgcggccta cgaggcccac       180
     ctcaaccggc cgtatgccgc tgagctggct tccggggtga ccggcacctt cgtggggagc       240
     gaggtctccc cctacgggcc gacgctcggg gtctcctacc cggccctgga cctcgatgca       300
     gcgctcgccg cggcacgggc tgccgtcccg gcctggcggg atgccggtcc gcaggtccgc       360
     gccgcggtgt gcgtcgagat cgtcgacgcg atcaacaggc ggtcgttcga ggtcgccaac       420
     gcggtcatgc acacgtcggg ccagccgttc gtgatgtcct tccaggcggg cgggccgcac       480
     gctcaggagc gggcgctcga ggcggtcgcc gcgggcctcg tcgagcagga gcgcgtgccg       540
     gcgtcggtcg tctgggagaa gccgggcaag gaccgcgagg gcaagccggc gccgatccgg       600
     atgcagaagg actaccgcat cgtcccgcgc ggcgtctccc tcgtcatcgg gtgcaacacc       660
     ttccccacgt ggaacgccta ccccgggatc ttcgcgtccc tcgtcaccgg gaacccggtc       720
     gtcatcaagc cgcatccccg cgccgtgctg cccctcgcga tcaccgtgga ggcggcccgg       780
     ggcgtgctcg ccgcggccgg cttcgacccg gcgctcgtcc agctcgccgc cgaggtcgac       840
     gggcagggcc tcgcgaggac gctggccgag cgggacgagg tcgcgatcat cgactacacc       900
     ggcgggccgg cgttcggcgg ctggctcgag gagcgcgggg cggccctcgg caagctcgtc       960
     tacaccgaga aggcgggcct caacacggtc gtcgtcgact cgaccgacga cctcaagggc      1020
     ctgctcggca acctcgcctt ctccctcacg ctctactcgg ggcagatgtg caccgcaccg      1080
     cagaacatct acgtgccgac cggtggcgtc gacaccgacg agggccatct gtccttcgac      1140
     gagttcggcg agcggctcgg ctccgcggtg tcccgcctga ccggtgacga cgcgaaggcg      1200
     gtcgagctgc tcggcgcgac ggtcaacgac caggtgcgcg ccaacgccga gtccctcgag      1260
     gcgatggccg ccgaggcgga gggccgcgtg ctgctccagt cgcggcggat cgcccacccg      1320
     gtctatgcgg aggcggtcgt ccgggcgccg gggctggtcg cggtggacgt gcagcgcgag      1380
     gacgtctaca cgcaggagtg cttcgggccc gtcgggttcc tcatccagac cgcctcgacc      1440
     gagcagtcgt tggcgcagct ggccgacacg gtcaaggagc acggcgggat gacggcgtcg      1500
     gtctactcga cgagtgaaga ggtcctcgaa ggggcgcggg aagcggcggc gaccggcggc      1560
     gtcgcgctgt ccgagaacct caccggccag atcttcgtga accagaccgc ggcgttctcc      1620
     gacttccacg gcaccggcgc gaatccggcg gcgaacgccg cctacaccga ctcggcgttc      1680
     gtcgcgaacc gcttccgcgt catcaccgcc cgccgccaca tctga                      1725
//

If you have problems or comments...

PBIL Back to PBIL home page