(data stored in SCRATCH zone)

EMBL: CP002343.PE237

CP002343.PE237       Location/Qualifiers
FT   CDS_pept        complement(262586..263782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0242"
FT                   /product="nuclease SbcCD, D subunit"
FT                   /note="COGs: COG0420 DNA repair exonuclease; InterPro
FT                   IPR004843: IPR004593; KEGG: cmi:CMM_0677 putative dsDNA
FT                   exonuclease subunit; PFAM: metallophosphoesterase; SPTR:
FT                   Putative dsDNA exonuclease subunit; TIGRFAM: nuclease
FT                   SbcCD, D subunit; manually curated; PFAM: Calcineurin-like
FT                   phosphoesterase; Type 5 capsule protein repressor C
FT                   terminal; TIGRFAM: exonuclease SbcD"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46799"
FT                   /db_xref="GOA:E6S6R3"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6R3"
FT                   /protein_id="ADU46799.1"
FT                   /translation="MRMLHTSDWHLGRTLHGVSLHEAQAAVLERICELVEDPPDGVPVD
FT                   AVIVAGDVYDRGVPPVESVQLFEWTLSRLSQVTTVVVTSGNHDSAIRLGYGAGLFRDTI
FT                   RMITDLSMVDLPVLLDGSDGVRAAIYGIPYLDVDHARAALARGGELLPRSHQAVVGAAC
FT                   DRIREDLRARTGVRSVVVAHAFVAGAEPSDSERSIAVGGVDRVAGTVFAGLDYAALGHL
FT                   HGPQSPECAEGSVVRYSGSPLRYSFSEQDHAKCVLLVDLPAAGPVVVTPLPITQPRPMA
FT                   TLRGMLDDLLADPAHAMHEDAWLRVTLTDRVRPDSLMDRLKSRFPHVLQVFHEPDGRIE
FT                   RGVRGTTAVSERDPRELGSDFISYVTKTEASTGEIGCFVAGYEAAVKAQALAEAQEVA"
     atgcggatgc tccacacgtc ggactggcac ctcgggcgca ccctccacgg ggtgagcctc        60
     cacgaggcgc aggccgctgt gctcgagcgg atctgcgagc tcgtcgagga cccgcccgac       120
     ggcgtgccgg tcgacgcggt catcgtggcc ggcgacgtct acgaccgcgg ggtgccgccg       180
     gtcgagtcgg tccagctctt cgagtggacc ctgtcgcgcc tgtcccaggt caccaccgtc       240
     gtcgtcacct cgggcaacca cgactcggcg atccggctcg gctacggcgc ggggctgttc       300
     cgcgacacca tccggatgat caccgacctc tcgatggtcg acctgcccgt gctcctcgac       360
     gggtccgacg gggtgcgggc ggcgatctac gggatcccct acctcgacgt cgaccacgcc       420
     cgcgcggcgc tcgcccgcgg cggtgagctc ctcccccggt cgcaccaggc ggtcgtcggc       480
     gcggcctgcg accggatccg cgaggacctc agggcccgca ccggggtgcg ctctgtcgtc       540
     gtcgcgcatg ccttcgtcgc cggtgccgag ccgagcgact ccgagcgttc gatcgccgtc       600
     ggtggcgtcg accgcgtcgc gggcaccgtc ttcgcggggc tggactacgc ggccctcggc       660
     cacctgcacg gcccccagtc gcccgagtgc gccgaggggt cggtggtccg ctactcggga       720
     tcgccgctgc gctactcgtt ctccgagcag gaccacgcca agtgcgtcct tctcgtcgac       780
     ctgcccgccg ccgggcccgt cgtcgtgacc ccgctcccga tcacccagcc tcgcccgatg       840
     gccaccctcc gcgggatgct cgacgacctg ctcgccgacc ccgcgcacgc gatgcacgag       900
     gacgcatggc tgcgggtgac cctgacggac cgggtccggc ccgactccct gatggaccgg       960
     ctcaagtccc ggttcccgca cgtcctccag gtcttccacg agccggacgg gcggatcgag      1020
     cgcggcgtgc gcgggacgac cgccgtcagc gagcgcgacc cgcgcgagct cgggtccgac      1080
     ttcatctcct acgtgacgaa gaccgaggcg agcaccggcg agatcggctg cttcgtcgcc      1140
     ggctacgagg cggccgtcaa ggcccaggcg ctcgccgagg cccaggaggt ggcctga         1197
//

If you have problems or comments...

PBIL Back to PBIL home page