(data stored in ACNUC7421 zone)

EMBL: CP002343.PE238

CP002343.PE238       Location/Qualifiers
FT   CDS_pept        264033..264503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0243"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fre:Franean1_6978 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46800"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6R4"
FT                   /protein_id="ADU46800.1"
FT                   /translation="MSREFQVTFDAADPIGLSLFWAEALGYVVQPPPGSDLSPETPAEE
FT                   VVEAWMSFLTATGVAIERHRSASAIVDPTGSGPRVFFQQVPEPKTAKNRVHLDVRAAPG
FT                   LEGDERMAALEAECQRLISLGAKRIRRFEPVPPMSAGFIVMADPDGNEFCLD"
     atgagccgcg agttccaggt caccttcgat gccgccgacc cgatcggcct gagcctgttc        60
     tgggcggagg ccctgggcta cgtcgtccaa ccccctccgg gcagcgacct gtcgccggag       120
     accccggccg aagaggtggt cgaggcgtgg atgtccttcc tcaccgccac cggcgtggcg       180
     atcgagcggc accgttcggc gtcggcgatc gtcgacccga cggggtccgg accgcgggtg       240
     ttcttccaac aggtccccga gcccaagacc gcgaagaacc gcgtccacct cgacgtccgg       300
     gccgcgccgg gcctcgaggg cgacgagcgg atggccgcgc tcgaggccga gtgccagcgg       360
     ctcatctcgt tgggcgccaa gaggatccgc cgcttcgagc cagtcccacc gatgtccgcc       420
     gggttcatcg tcatggcgga ccctgacggc aacgagttct gcctcgactg a                471
//

If you have problems or comments...

PBIL Back to PBIL home page