(data stored in SCRATCH zone)

EMBL: CP002343.PE239

CP002343.PE239       Location/Qualifiers
FT   CDS_pept        264520..264855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0244"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mav:MAV_2846 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: TfoX N-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46801"
FT                   /db_xref="InterPro:IPR007076"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6R5"
FT                   /protein_id="ADU46801.1"
FT                   /translation="MAYDEELANRIRFVIGPDPVVSEKKMFGGLAFLAHGNMAVAASGQ
FT                   GGLLVRVDPQRSDALVDDVHVRRMEMQGRQMAGWLRVDGDLVDEDAQLRRWVDEGLGYA
FT                   RTLPPKR"
     atggcctacg acgaggagct cgccaaccgg atccggttcg tgatcgggcc cgatccggtc        60
     gtctcggaga agaagatgtt cgggggcctg gccttcctgg cccacggcaa catggccgtc       120
     gcggcgagcg gccagggcgg cctgctcgtc cgagtcgatc cgcaacggtc ggacgcactc       180
     gtcgacgacg tgcacgtccg ccggatggag atgcagggcc ggcagatggc cgggtggctg       240
     cgcgtcgacg gtgacctggt cgacgaggat gcgcagctgc gcaggtgggt cgacgagggt       300
     ctcggctacg cccgcacgct gccaccgaaa cgctga                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page