(data stored in ACNUC7421 zone)

EMBL: CP002343.PE24

CP002343.PE24        Location/Qualifiers
FT   CDS_pept        complement(25421..25642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0024"
FT                   /product="protein of unknown function DUF397"
FT                   /note="InterPro IPR007278; KEGG: tbi:Tbis_0235 hypothetical
FT                   protein; PFAM: protein of unknown function DUF397; SPTR:
FT                   Putative uncharacterized protein; PFAM: Domain of unknown
FT                   function (DUF397)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46586"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEI5"
FT                   /protein_id="ADU46586.1"
FT                   /translation="MKPDWNTAAWRKSVISDTGACVEVAHSAGMVGVRDSKARGQGSIL
FT                   EFTEAEWRAFTGGVRNGEFDYDELRKSG"
     atgaagccgg actggaacac cgctgcatgg cgaaaatccg tcatcagcga cacgggcgcg        60
     tgcgtcgagg tcgcccactc agcggggatg gtgggtgtcc gcgactccaa ggcccgaggc       120
     caaggaagca tcctcgagtt caccgaggcc gaatggcgcg cgttcaccgg cggtgtccgg       180
     aacggcgagt tcgactacga cgagctgcga aagtcgggat ga                          222
//

If you have problems or comments...

PBIL Back to PBIL home page