(data stored in SCRATCH zone)

EMBL: CP002343.PE240

CP002343.PE240       Location/Qualifiers
FT   CDS_pept        complement(265109..265492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0245"
FT                   /product="membrane protein of unknown function"
FT                   /note="InterPro IPR007165; KEGG: kse:Ksed_02330 predicted
FT                   membrane protein; PFAM: membrane protein of unknown
FT                   function; SPTR: Predicted membrane protein; PFAM: Membrane
FT                   protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46802"
FT                   /db_xref="GOA:E6S6R6"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6R6"
FT                   /protein_id="ADU46802.1"
FT                   /translation="MLLNFVIKTVINGIALWIAALLVDGITFGTQADTAAIVRTVLIVA
FT                   LIFGVLNTFVRPIAKAVSLPFIILTLGLFVFIINALMLQLTSWLADQLNLAFHVEHFFW
FT                   DAVLGSLIITFVSMILGFFNPKD"
     atgctgctca acttcgtgat caagaccgtc atcaacggca tcgcgctctg gatcgccgcc        60
     ctcctcgtcg acgggatcac cttcgggacc caggcggaca cggcggccat cgtccgcacc       120
     gtcctgatcg tcgcgctgat cttcggtgtc ctcaacacgt tcgtgcggcc gatcgcgaag       180
     gccgtgtccc tccccttcat catcctgacg ctcgggctgt tcgtcttcat catcaacgcg       240
     ttgatgctgc agctgacctc gtggctcgcc gaccagctca acctcgcctt ccacgtcgag       300
     cacttcttct gggacgcggt gctcggatcg ctcatcatca ccttcgtgtc gatgatcctg       360
     gggttcttca accccaagga ctga                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page