(data stored in ACNUC7421 zone)

EMBL: CP002343.PE243

CP002343.PE243       Location/Qualifiers
FT   CDS_pept        268074..269228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0248"
FT                   /product="pyruvate dehydrogenase (acetyl-transferring) E1
FT                   component, alpha subunit"
FT                   /EC_number="1.2.4.1"
FT                   /note="COGs: COG1071 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex dehydrogenase (E1) component eukaryotic type alpha
FT                   subunit; InterPro IPR001017: IPR017596; KEGG: nca:Noca_4509
FT                   pyruvate dehydrogenase (acetyl-transferring); PFAM:
FT                   dehydrogenase E1 component; PRIAM: Pyruvate dehydrogenase
FT                   (acetyl-transferring); SPTR: Pyruvate dehydrogenase
FT                   (Acetyl-transferring); TIGRFAM: pyruvate dehydrogenase
FT                   (acetyl-transferring) E1 component, alpha subunit; PFAM:
FT                   Dehydrogenase E1 component; TIGRFAM: pyruvate dehydrogenase
FT                   E1 component, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46805"
FT                   /db_xref="GOA:E6S6R9"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017596"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6R9"
FT                   /protein_id="ADU46805.1"
FT                   /translation="MSDKVVAELHEPTPAVGDGGPDMIQLLTPEGERLSHPDYDKYVAD
FT                   LTPEDLRSFYRDLVLIRRLDAEGYALQRQGELGLWPSLLGQEAAQVGSGRALKPHDMCF
FT                   PTYREHGVGFVRGMDPQSSLQLFRGVSQGGWDPKDHNFHLYTIVIGAQTLHATGYAMGV
FT                   KMDGNVGTGDPDRDTAVICYFGDGASSQGDVNEAFVYAASFDAPVVFFCQNNQWAISEP
FT                   VSKQTRIPLFQRARGFGFPGMRVDGNDVLATYAVTQHCLDEARNGNGPLLIEAFTYRMG
FT                   AHTTADDPTKYRVSAEVEQWKFRDPILRLKTYLSHEGWADEAFFTRVDEEADQFAAELR
FT                   HGCITMDTMPGETMWDHVYAEDHPVMEAERAAFQAYQASFEEAN"
     gtgagcgaca aagtagtcgc cgagctgcac gagccgaccc cagcggtcgg tgacggcggc        60
     ccggacatga tccagctgct gacccccgag ggggaacgcc tctcccaccc cgactacgac       120
     aagtacgtcg cggacctgac gcccgaggat ctccggagct tctaccgcga cctcgtgctc       180
     atccgccgcc tcgacgccga ggggtacgcg ctccagcgcc agggtgagct cgggctgtgg       240
     cccagcctgc tcggccagga ggccgcccag gtcggctcgg gccgggcgct caagccgcac       300
     gacatgtgct tccccaccta ccgtgagcac ggcgtcggct tcgtgcgggg catggacccg       360
     cagagctcgc ttcagctctt ccgcggggtg agccagggcg gctgggaccc gaaggaccac       420
     aacttccacc tctacacgat cgtcatcggc gcccagaccc tgcacgccac gggctacgcg       480
     atgggcgtga agatggacgg caacgtcggc acgggcgacc ccgaccgcga caccgccgtc       540
     atctgctact tcggcgacgg tgcatcctcg cagggcgatg tcaacgaggc gttcgtctac       600
     gccgcgtcgt tcgacgcccc ggtcgtgttc ttctgccaga acaaccagtg ggcgatctcc       660
     gagccggtct cgaagcagac ccgcatcccg ctcttccagc gcgcccgcgg cttcggcttc       720
     ccggggatgc gcgtcgacgg caacgacgtc ctcgcgacct acgccgtgac gcagcactgc       780
     ctggacgagg cgcgcaacgg caacggtccg ctcctcatcg aggcgttcac ctatcggatg       840
     ggcgcgcaca cgacggctga cgaccccacg aagtaccgcg tctccgccga ggtcgagcag       900
     tggaagttcc gcgacccgat cctgcgcctc aagacgtacc tgtcccacga gggctgggcc       960
     gacgaggcct tcttcacccg ggtcgacgag gaggccgacc agttcgccgc cgagctgcgc      1020
     cacggctgca tcacgatgga cacgatgccc ggcgagacga tgtgggacca cgtctacgcg      1080
     gaggaccacc cggtcatgga ggccgagcgc gccgcgttcc aggcctacca ggcgagcttc      1140
     gaggaggcga actga                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page